Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TXNIP Polyclonal Antibody – Cat# AAA200220 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TXNIP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Thioredoxin-Interacting Protein Isoform 1 (TXNIP) Antibody – Rabbit Polyclonal

TXNIP antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
TXNIP; THIF; VDUP1; ARRDC6; HHCPA78; EST01027
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TXNIP, Antibody; TXNIP antibody - C-terminal region; anti-TXNIP antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP
Sequence Length
391
Applicable Applications for anti-TXNIP antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TXNIP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-TXNIP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Rabbit Anti-TXNIP Polyclonal Antibody – Cat# AAA200220 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TXNIP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

WB (Western Blot)

(Researcher: AnonymousApplication: Western BlottingSpecies + Tissue/Cell type: Lane 1: 20ug mouse mesenchymal stem cell lysatePrimary antibody dilution: 1:2000Secondary antibody: Anti-rabbit-HRPSecondary antibody dilution: 1:10,000)

Rabbit Anti-TXNIP Polyclonal Antibody – Cat# AAA200220 – WB (Western Blot) WB (Western Blot) (Researcher: AnonymousApplication: Western BlottingSpecies + Tissue/Cell type: Lane 1: 20ug mouse mesenchymal stem cell lysatePrimary antibody dilution: 1:2000Secondary antibody: Anti-rabbit-HRPSecondary antibody dilution: 1:10,000)

WB (Western Blot)

(Host: RabbitTarget Name: TXNIPSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-TXNIP Polyclonal Antibody – Cat# AAA200220 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: TXNIPSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: TXNIPSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit Anti-TXNIP Polyclonal Antibody – Cat# AAA200220 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: TXNIPSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: TXNIPSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-TXNIP Polyclonal Antibody – Cat# AAA200220 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: TXNIPSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TXNIP antibody
This is a rabbit polyclonal antibody against TXNIP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
thioredoxin-interacting protein isoform 1
NCBI Official Synonym Full Names
thioredoxin interacting protein
NCBI Official Symbol
TXNIP
NCBI Official Synonym Symbols
THIF; VDUP1; ARRDC6; HHCPA78; EST01027
NCBI Protein Information
thioredoxin-interacting protein
UniProt Protein Name
Thioredoxin-interacting protein
UniProt Gene Name
TXNIP
UniProt Synonym Gene Names
VDUP1
UniProt Entry Name
TXNIP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TXNIP txnip (Catalog #AAA200220) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TXNIP antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TXNIP can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TXNIP txnip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DTPEAPPCYM DVIPEDHRLE SPTTPLLDDM DGSQDSPIFM YAPEFKFMPP. It is sometimes possible for the material contained within the vial of "TXNIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.