Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Anti-STAT1 Polyclonal Antibody – Cat# AAA46578 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Anti- STAT1 Picoband antibody, AAA46578, IHC(P)IHC(P): Human Mammary Cancer Tissue)

Signal Transducer And Activator Of Transcription 1-Alpha/Beta Isoform Alpha (STAT1) Antibody – Polyclonal

Anti-STAT1 Antibody

Average rating 0.0
No ratings yet
Gene Names
STAT1; CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
STAT1, Antibody; Anti-STAT1 Antibody; Signal transducer and activator of transcription 1-alpha/beta; Signal transducer and activator of transcription 1 91kD; DKFZp686B04100; ISGF 3; ISGF-3; OTTHUMP00000163552; OTTHUMP00000165046; OTTHUMP00000165047; OTTHUMP00000205845; Signal transducer and activator of transcription 1 91kDa; Signal transducer and activator of transcription 1 alpha/ beta; Signal transducer and activator of transcription 1; Signal transducer and activator of transcription 1, 91kD; Signal Transductor and Activator of Transcription 1; STAT 1; STAT 91; Stat1; STAT1_HUMAN; STAT91; Transcription factor ISGF 3 components p91 p84; Transcription factor ISGF-3 components p91/p84; signal transducer and activator of transcription 1, 91kDa; anti-STAT1 antibody
Ordering

Product Overview

Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
750
Applicable Applications for anti-STAT1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human STAT1 (114-143aa KILENAQRFNQAQSGNIQSTVMLDKQKELD), different from the related mouse sequence by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- STAT1 Picoband antibody, AAA46578, IHC(P)IHC(P): Human Mammary Cancer Tissue)

Anti-STAT1 Polyclonal Antibody – Cat# AAA46578 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Anti- STAT1 Picoband antibody, AAA46578, IHC(P)IHC(P): Human Mammary Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- STAT1 Picoband antibody, AAA46578, IHC(P)IHC(P): Rat Intestine Tissue)

Anti-STAT1 Polyclonal Antibody – Cat# AAA46578 – IHC (Immunohistochemisry) IHC (Immunohistochemisry) (Anti- STAT1 Picoband antibody, AAA46578, IHC(P)IHC(P): Rat Intestine Tissue)

IHC (Immunohiostchemistry)

(Anti- STAT1 Picoband antibody, AAA46578, IHC(P)IHC(P): Mouse Intestine Tissue)

Anti-STAT1 Polyclonal Antibody – Cat# AAA46578 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Anti- STAT1 Picoband antibody, AAA46578, IHC(P)IHC(P): Mouse Intestine Tissue)

WB (Western Blot)

(Anti- STAT1 Picoband antibody, AAA46578, Western blottingAll lanes: Anti STAT1 (AAA46578) at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: Rat Liver Tissue Lysate at 50ugLane 4: Human Placenta Tissue Lysate at 50ugLane 5: MCF-7 Whole Cell Lysate at 40ugLane 6: SW620 Whole Cell Lysate at 40ugPredicted bind size: 91KD(Alpha), 84KD(Beta)Observed bind size: 91KD(Alpha), 84KD(Beta))

Anti-STAT1 Polyclonal Antibody – Cat# AAA46578 – WB (Western Blot) WB (Western Blot) (Anti- STAT1 Picoband antibody, AAA46578, Western blottingAll lanes: Anti STAT1 (AAA46578) at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: Rat Liver Tissue Lysate at 50ugLane 4: Human Placenta Tissue Lysate at 50ugLane 5: MCF-7 Whole Cell Lysate at 40ugLane 6: SW620 Whole Cell Lysate at 40ugPredicted bind size: 91KD(Alpha), 84KD(Beta)Observed bind size: 91KD(Alpha), 84KD(Beta))
Related Product Information for anti-STAT1 antibody
Description: Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 1-alpha/beta (STAT1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: The crystal structure of the DNA complex of a 67-kD core fragment of the STAT1 homodimer was determined, lacking only the N-domain and the C-terminal transcriptional activation domain, at 2.9-angstrom resolution. Phosphorylation of Signal Transducer and Activator of transcription 1(STAT 1) was also decreased in rheumatoid arthritis lymphocytes. The transcription factor signal transducer and activator of transcription-1 (STAT1) plays a key role in immunity against mycobacterial and viral infections. Activation of the signal transducers and activators of transcription (STAT) pathway is important in fibroblast growth factor (FGF) modulation of chondrocyte proliferation and endochondral bone formation during embryogenesis.
References
1. Chapgier, A.; Boisson-Dupuis, S.; Jouanguy, E.; Vogt, G.; Feinberg, J.; Prochnicka-Chalufour, A.; Casrouge, A.; Yang, K.; Soudais, C.; Fieschi, C.; Santos, O. F.; Bustamante, J.; and 10 others : Novel STAT1 alleles in otherwise healthy patients with mycobacterial disease. PLoS Genet. 2: e131, 2006. Note: Electronic Article. 2. Ihle, J. N. : STATs: signal transducers and activators of transcription. Cell 84: 331-334, 1996. 3. Xiao, L.; Naganawa, T.; Obugunde, E.; Gronowicz, G.; Ornitz, D. M.; Coffin, J. D.; Hurley, M. M. : Stat1 controls postnatal bone formation by regulating fibroblast growth factor signaling in osteoblasts. J. Biol. Chem. 279: 27743-27752, 2004.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83,043 Da
NCBI Official Full Name
signal transducer and activator of transcription 1-alpha/beta isoform alpha
NCBI Official Synonym Full Names
signal transducer and activator of transcription 1
NCBI Official Symbol
STAT1
NCBI Official Synonym Symbols
CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91
NCBI Protein Information
signal transducer and activator of transcription 1-alpha/beta
UniProt Protein Name
Signal transducer and activator of transcription 1-alpha/beta
UniProt Gene Name
STAT1
UniProt Entry Name
STAT1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The STAT1 stat1 (Catalog #AAA46578) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-STAT1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STAT1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the STAT1 stat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.