Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197270_WB11.jpg WB (Western Blot) (WB Suggested Anti-SMAD4 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit SMAD4 Polyclonal Antibody | anti-SMAD4 antibody

SMAD4 antibody - middle region

Gene Names
SMAD4; JIP; DPC4; MADH4; MYHRS
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
SMAD4, Antibody; SMAD4 antibody - middle region; anti-SMAD4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNST
Sequence Length
552
Applicable Applications for anti-SMAD4 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 92%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SMAD4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SMAD4 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA197270_WB11.jpg WB (Western Blot) (WB Suggested Anti-SMAD4 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(SMAD4 antibody - middle region validated by WB using U2OS nuclear extracts)

product-image-AAA197270_WB13.jpg WB (Western Blot) (SMAD4 antibody - middle region validated by WB using U2OS nuclear extracts)

WB (Western Blot)

(Sample Type: Human U2OSSample Type: Human nuclear cell extracts (30ug)Primary Dilution: 1:1000Secondary Antibody: anti-Rabbit HRPSecondary Dilution: 1:20000Image Submitted By:  Katarina LuciakovaCancer Research Institute See Customer Feedback tab for detailed information.)

product-image-AAA197270_WB15.jpg WB (Western Blot) (Sample Type: Human U2OSSample Type: Human nuclear cell extracts (30ug)Primary Dilution: 1:1000Secondary Antibody: anti-Rabbit HRPSecondary Dilution: 1:20000Image Submitted By:  Katarina LuciakovaCancer Research Institute See Customer Feedback tab for detailed information.)
Related Product Information for anti-SMAD4 antibody
This is a rabbit polyclonal antibody against SMAD4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SMAD4 is one of the Smad family members, which are essential intracellular signalling components of the transforming growth factor-beta (TGF-beta) superfamily. Smad2 and Smad3 are structurally highly similar and mediate TGF-beta signals. Smad4 is distantly related to Smads 2 and 3, and forms a heteromeric complex with Smad2 after TGF-beta or activin stimulation. TGF-beta induces heteromeric complexes of Smads 2, 3 and 4, and their concomitant translocation to the nucleus, which is required for efficient TGF-beta signal transduction

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
mothers against decapentaplegic homolog 4
NCBI Official Synonym Full Names
SMAD family member 4
NCBI Official Symbol
SMAD4
NCBI Official Synonym Symbols
JIP; DPC4; MADH4; MYHRS
NCBI Protein Information
mothers against decapentaplegic homolog 4
UniProt Protein Name
Mothers against decapentaplegic homolog 4
UniProt Gene Name
SMAD4
UniProt Synonym Gene Names
DPC4; MADH4; MAD homolog 4; Mothers against DPP homolog 4; SMAD 4; Smad4; hSMAD4
UniProt Entry Name
SMAD4_HUMAN

Similar Products

Product Notes

The SMAD4 smad4 (Catalog #AAA197270) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMAD4 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SMAD4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SMAD4 smad4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NIPVASTSQP ASILGGSHSE GLLQIASGPQ PGQQQNGFTG QPATYHHNST. It is sometimes possible for the material contained within the vial of "SMAD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.