Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SHH Polyclonal Antibody – Cat# AAA23516 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SHH Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Sonic Hedgehog Protein Isoform 1 Preproprotein (SHH) Antibody – Rabbit Polyclonal

SHH antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SHH; TPT; HHG1; HLP3; HPE3; SMMCI; ShhNC; TPTPS; MCOPCB5
Reactivity
Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish, Chicken (Tested Reactivity: Human, Mouse, Chicken)
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SHH, Antibody; SHH antibody - N-terminal region; anti-SHH antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish, Chicken (Tested Reactivity: Human, Mouse, Chicken)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
Sequence Length
462
Applicable Applications for anti-SHH antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SHH
Protein Size
462 amino acids
Protein Interactions
UBC; SEL1L; DERL2; DERL1; SYVN1; HHIP; PTCH2; PTCH1; SHH; ADCYAP1; GAS1.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SHH Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit Anti-SHH Polyclonal Antibody – Cat# AAA23516 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SHH Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: SHHSample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

Rabbit Anti-SHH Polyclonal Antibody – Cat# AAA23516 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: SHHSample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: SHHSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Rabbit Anti-SHH Polyclonal Antibody – Cat# AAA23516 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: SHHSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type :Human glioma cellsPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-GFPSecondary Antibody Dilution :1:500Color/Signal Descriptions :1. SHH: Green 2. DAPI: Blue 3. MergeGene Name :SHHSubmitted by :ELIAS EL HABR, PhD, Post-Doctoral fellow, INSERM U894 Glial Plasticity Team, Psychiatry& Neurosciences Center, St Anne Hospital, 2 Ter, Rue d'Alesia, 75014 Paris)

Rabbit Anti-SHH Polyclonal Antibody – Cat# AAA23516 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type :Human glioma cellsPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-GFPSecondary Antibody Dilution :1:500Color/Signal Descriptions :1. SHH: Green 2. DAPI: Blue 3. MergeGene Name :SHHSubmitted by :ELIAS EL HABR, PhD, Post-Doctoral fellow, INSERM U894 Glial Plasticity Team, Psychiatry& Neurosciences Center, St Anne Hospital, 2 Ter, Rue d'Alesia, 75014 Paris)

IHC (Immunohistochemistry)

(Rabbit Anti-SHH AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: Plasma membrane, CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-SHH Polyclonal Antibody – Cat# AAA23516 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-SHH AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: Plasma membrane, CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Sample Type: Chicken embryosChicken embryosPrimary antibody: 1:1000 (AAA23516) anti -shhSecondary Antibody: 1:500 goat anti-rabbit HRP conjugated)

Rabbit Anti-SHH Polyclonal Antibody – Cat# AAA23516 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type: Chicken embryosChicken embryosPrimary antibody: 1:1000 (AAA23516) anti -shhSecondary Antibody: 1:500 goat anti-rabbit HRP conjugated)
Related Product Information for anti-SHH antibody
This is a rabbit polyclonal antibody against SHH. It was validated on Western Blot and immunohistochemistry

Target Description: SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.This gene, which is expressed only during embryogenesis, encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. In addition, it is thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
sonic hedgehog protein isoform 1 preproprotein
NCBI Official Synonym Full Names
sonic hedgehog signaling molecule
NCBI Official Symbol
SHH
NCBI Official Synonym Symbols
TPT; HHG1; HLP3; HPE3; SMMCI; ShhNC; TPTPS; MCOPCB5
NCBI Protein Information
sonic hedgehog protein
UniProt Protein Name
Sonic hedgehog protein
UniProt Gene Name
SHH
UniProt Synonym Gene Names
SHH
UniProt Entry Name
SHH_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SHH shh (Catalog #AAA23516) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHH antibody - N-terminal region reacts with Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish, Chicken (Tested Reactivity: Human, Mouse, Chicken) and may cross-react with other species as described in the data sheet. AAA Biotech's SHH can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the SHH shh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RCLLLVLVSS LLVCSGLACG PGRGFGKRRH PKKLTPLAYK QFIPNVAEKT. It is sometimes possible for the material contained within the vial of "SHH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.