Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-S100A8 Polyclonal Antibody – Cat# AAA201084 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-S100A8 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Protein S100-A8 Isoform D (S100A8) Antibody – Rabbit Polyclonal

S100A8 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
S100A8; P8; MIF; NIF; CAGA; CFAG; CGLA; L1Ag; MRP8; CP-10; MA387; 60B8AG
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
S100A8, Antibody; S100A8 antibody - middle region; anti-S100A8 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Sequence Length
93
Applicable Applications for anti-S100A8 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-S100A8 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Rabbit Anti-S100A8 Polyclonal Antibody – Cat# AAA201084 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-S100A8 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

IHC (Immunohiostchemistry)

(Rabbit Anti-S100A8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: SecretedPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-S100A8 Polyclonal Antibody – Cat# AAA201084 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Rabbit Anti-S100A8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: SecretedPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Rabbit Anti-S100A8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart TissueObserved Staining: Cytoplasm in endothelial cells in capillariesPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-S100A8 Polyclonal Antibody – Cat# AAA201084 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-S100A8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart TissueObserved Staining: Cytoplasm in endothelial cells in capillariesPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-S100A8 antibody
This is a rabbit polyclonal antibody against S100A8. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis.
Product Categories/Family for anti-S100A8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
protein S100-A8 isoform d
NCBI Official Synonym Full Names
S100 calcium binding protein A8
NCBI Official Symbol
S100A8
NCBI Official Synonym Symbols
P8; MIF; NIF; CAGA; CFAG; CGLA; L1Ag; MRP8; CP-10; MA387; 60B8AG
NCBI Protein Information
protein S100-A8
UniProt Protein Name
Protein S100-A8
UniProt Gene Name
S100A8
UniProt Synonym Gene Names
CAGA; CFAG; MRP8; CFAG; MRP-8; p8
UniProt Entry Name
S10A8_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The S100A8 s100a8 (Catalog #AAA201084) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100A8 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's S100A8 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the S100A8 s100a8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QYIRKKGADV WFKELDINTD GAVNFQEFLI LVIKMGVAAH KKSHEESHKE. It is sometimes possible for the material contained within the vial of "S100A8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.