Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-RXRA Polyclonal Antibody – Cat# AAA23431 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RXRA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Retinoic Acid Receptor RXR-Alpha Isoform A (RXRA) Antibody – Rabbit Polyclonal

RXRA antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
RXRA; NR2B1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RXRA, Antibody; RXRA antibody - N-terminal region; anti-RXRA antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF
Sequence Length
462
Applicable Applications for anti-RXRA antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 78%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 78%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RXRA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RXRA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit Anti-RXRA Polyclonal Antibody – Cat# AAA23431 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RXRA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

WB (Western Blot)

(Host: RatTarget Name: RXRASample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

Rabbit Anti-RXRA Polyclonal Antibody – Cat# AAA23431 – WB (Western Blot) WB (Western Blot) (Host: RatTarget Name: RXRASample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RXRASample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-RXRA Polyclonal Antibody – Cat# AAA23431 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: RXRASample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RXRASample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Rabbit Anti-RXRA Polyclonal Antibody – Cat# AAA23431 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: RXRASample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RXRASample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Rabbit Anti-RXRA Polyclonal Antibody – Cat# AAA23431 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: RXRASample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: RXRASample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit Anti-RXRA Polyclonal Antibody – Cat# AAA23431 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: RXRASample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RXRA antibody
This is a rabbit polyclonal antibody against RXRA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription. RXRA is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators.Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription. The protein encoded by this gene is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
retinoic acid receptor RXR-alpha isoform a
NCBI Official Synonym Full Names
retinoid X receptor alpha
NCBI Official Symbol
RXRA
NCBI Official Synonym Symbols
NR2B1
NCBI Protein Information
retinoic acid receptor RXR-alpha
UniProt Protein Name
Retinoic acid receptor RXR-alpha
UniProt Gene Name
RXRA
UniProt Synonym Gene Names
NR2B1
UniProt Entry Name
RXRA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RXRA rxra (Catalog #AAA23431) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RXRA antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RXRA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RXRA rxra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GPGIGSPGQL HSPISTLSSP INGMGPPFSV ISSPMGPHSM SVPTTPTLGF. It is sometimes possible for the material contained within the vial of "RXRA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.