Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-Rnase2 Polyclonal Antibody – Cat# AAA14729 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of RNASE2 expression in transfected 293T cell line using AAA14729. Lane 1: RNASE2 transfected lysate (18.40kD). Lane 2: Non-transfected lysate.)

Ribonuclease, Rnase A Family, 2 (Liver, Eosinophil-Derived Neurotoxin) (Rnase2) Antibody – Rabbit Polyclonal

RNASE2 (Non-secretory Ribonuclease, Eosinophil-derived Neurotoxin, RNase UpI-2, Ribonuclease 2, RNase 2, Ribonuclease US, EDN, RNS2)

Average rating 0.0
No ratings yet
Gene Names
Rnase2; R5; R14; R15; Ear4
Reactivity
Human
Applications
Western Blot
Purity
Purified
Purified.
Synonyms
RNASE2, Antibody; RNASE2 (Non-secretory Ribonuclease, Eosinophil-derived Neurotoxin, RNase UpI-2, Ribonuclease 2, RNase 2, Ribonuclease US, EDN, RNS2); Anti -RNASE2 (Non-secretory Ribonuclease, Eosinophil-derived Neurotoxin, RNase UpI-2, Ribonuclease 2, RNase 2, Ribonuclease US, EDN, RNS2); anti-Rnase2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RNASE2.
Purity/Purification
Purified
Purified.
Form/Format
Supplied as a liquid in PBS, pH 7.4.
Concentration
1 mg/ml (varies by lot)
Sequence
MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Applicable Applications for anti-Rnase2 antibody
WB (Western Blot)
Application Notes
Suitable for use in Western Blot. Other applications not tested. Optimal dilutions to be determined by the researcher.
Immunogen
Full-length recombinant protein corresponding to aa1-161 from human RNASE2 (NP_002925.1)
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, 11c7entrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of RNASE2 expression in transfected 293T cell line using AAA14729. Lane 1: RNASE2 transfected lysate (18.40kD). Lane 2: Non-transfected lysate.)

Rabbit Anti-Rnase2 Polyclonal Antibody – Cat# AAA14729 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of RNASE2 expression in transfected 293T cell line using AAA14729. Lane 1: RNASE2 transfected lysate (18.40kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot analysis of RNASE2 expression in human spleen using AAA14729.)

Rabbit Anti-Rnase2 Polyclonal Antibody – Cat# AAA14729 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of RNASE2 expression in human spleen using AAA14729.)
Related Product Information for anti-Rnase2 antibody
Eosinophil derived neurotoxin (EDN) is a protein belonging to the ribonuclease (RNase) A superfamily. It has recently been found to have antiviral activity against respiratory syncytial virus and human immunodeficiency virus in vitro.
Product Categories/Family for anti-Rnase2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
NCBI Official Synonym Full Names
ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
NCBI Official Symbol
Rnase2
NCBI Official Synonym Symbols
R5; R14; R15; Ear4
NCBI Protein Information
ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin); ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin); ribonuclease 5; ribonuclease 14; ribonuclease 15; pre-eosinophil-associated ribonuclease-2; eosinophil-associated, ribonuclease A family, member 4

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The Rnase2 (Catalog #AAA14729) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNASE2 (Non-secretory Ribonuclease, Eosinophil-derived Neurotoxin, RNase UpI-2, Ribonuclease 2, RNase 2, Ribonuclease US, EDN, RNS2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNASE2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Suitable for use in Western Blot. Other applications not tested. Optimal dilutions to be determined by the researcher. Researchers should empirically determine the suitability of the Rnase2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVPKLFTSQI CLLLLLGLLA VEGSLHVKPP QFTWAQWFET QHINMTSQQC TNAMQVINNY QRRCKNQNTF LLTTFANVVN VCGNPNMTCP SNKTRKNCHH SGSQVPLIHC NLTTPSPQNI SNCRYAQTPA NMFYIVACDN RDQRRDPPQY PVVPVHLDRI I. It is sometimes possible for the material contained within the vial of "RNASE2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.