Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-RELB Polyclonal Antibody – Cat# AAA198213 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RELB Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate)

Transcription Factor Relb Isoform 1 (RELB) Antibody – Rabbit Polyclonal

RELB antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
Relb; shep
Reactivity
Tested: Mouse Predicted: Cow, Dog, Human, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
RELB, Antibody; RELB antibody - N-terminal region; anti-RELB antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested: Mouse Predicted: Cow, Dog, Human, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
1.0 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: MPSRRAARESAPELGALGSSDLSSLSLTVSRTTDELEIIDEYIKENGFGL
Sequence Length
558
Applicable Applications for anti-RELB antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 93%; Human: 93%; Mouse: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse RELB
Protein Size (# AA)
558 amino acids
Protein Interactions
Nanog; Nfkb2; Nfkb1
Blocking Peptide
For anti-RELB (MBS3203796) antibody is Catalog # ( )
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RELB Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate)

Rabbit Anti-RELB Polyclonal Antibody – Cat# AAA198213 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RELB Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: RELBSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Rabbit Anti-RELB Polyclonal Antibody – Cat# AAA198213 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: RELBSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: RELBSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Rabbit Anti-RELB Polyclonal Antibody – Cat# AAA198213 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: RELBSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)
Related Product Information for anti-RELB antibody
This is a rabbit polyclonal antibody against RELB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RelB is a member of the Rel/nuclear factor (NF)-kappa B family of transcription factors, defects in RelB affects antigen presenting cells and the formation of lymphoid organs. Targeted disruption of the Rel/NF-kappaB family members NF-kappaB2, encoding p100/p52, and RelB in mice results in anatomical defects of secondary lymphoid tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
transcription factor RelB isoform 1
NCBI Official Synonym Full Names
avian reticuloendotheliosis viral (v-rel) oncogene related B
NCBI Official Symbol
Relb
NCBI Official Synonym Symbols
shep
NCBI Protein Information
transcription factor RelB
UniProt Protein Name
Transcription factor RelB
UniProt Gene Name
Relb
UniProt Entry Name
RELB_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RELB relb (Catalog #AAA198213) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RELB antibody - N-terminal region reacts with Tested: Mouse Predicted: Cow, Dog, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RELB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the RELB relb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPSRRAARES APELGALGSS DLSSLSLTVS RTTDELEIID EYIKENGFGL. It is sometimes possible for the material contained within the vial of "RELB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.