Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28623_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HEL cells using NFAT2 Rabbit pAb(AAA28623) at a dilution of 1:25 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit anti-Human NFAT2 Polyclonal Antibody | anti-NFAT2 antibody

NFAT2 Rabbit pAb

Reactivity
Human
Applications
Western Blot, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity purification
Synonyms
NFAT2, Antibody; NFAT2 Rabbit pAb; NFATC1; NF-ATC; NF-ATc1.2; NFAT2; NFATc; nuclear factor of activated T-cells 1; anti-NFAT2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
LPLVEKQSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLP
Applicable Applications for anti-NFAT2 antibody
Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA)
Application Notes
WB: 1:500-1:1000
IF/ICC: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant Protein corresponding to a sequence within amino acids 595-694 of human NFAT2(NP_001265598.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of HEL cells using NFAT2 Rabbit pAb(AAA28623) at a dilution of 1:25 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28623_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HEL cells using NFAT2 Rabbit pAb(AAA28623) at a dilution of 1:25 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using NFAT2 Rabbit pAb(AAA28623) at a dilution of 1:25 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28623_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using NFAT2 Rabbit pAb(AAA28623) at a dilution of 1:25 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of THP-1 cells using NFAT2 Rabbit pAb(AAA28623) at a dilution of 1:25 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28623_IF4.jpg IF (Immunofluorescence) (Immunofluorescence analysis of THP-1 cells using NFAT2 Rabbit pAb(AAA28623) at a dilution of 1:25 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using NFAT2 Rabbit pAb(AAA28623) at a dilution of 1:25 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28623_IF3.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using NFAT2 Rabbit pAb(AAA28623) at a dilution of 1:25 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of various lysates using NFAT2 Rabbit pAb (AAA28623) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)

product-image-AAA28623_WB2.jpg WB (Western Blot) (Western blot analysis of various lysates using NFAT2 Rabbit pAb (AAA28623) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)

WB (Western Blot)

(Western blot analysis of various lysates using NFAT2 Rabbit pAb (AAA28623) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

product-image-AAA28623_WB.jpg WB (Western Blot) (Western blot analysis of various lysates using NFAT2 Rabbit pAb (AAA28623) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)
Related Product Information for anti-NFAT2 antibody
The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
Calculated MW: 38kDa/74- 88kDa/100-101kDa
Observed MW: 70kDa
UniProt Protein Name
Nuclear factor of activated T-cells, cytoplasmic 1
UniProt Gene Name
NFATC1
UniProt Synonym Gene Names
NFAT2; NFATC; NF-ATc1; NFATc1; NF-ATc; NFATc
UniProt Entry Name
NFAC1_HUMAN

Similar Products

Product Notes

The NFAT2 nfatc1 (Catalog #AAA28623) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFAT2 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFAT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA). WB: 1:500-1:1000 IF/ICC: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the NFAT2 nfatc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LPLVEKQSTD SYPVVGGKKM VLSGHNFLQD SKVIFVEKAP DGHHVWEMEA KTDRDLCKPN SLVVEIPPFR NQRITSPVHV SFYVCNGKRK RSQYQRFTYL P. It is sometimes possible for the material contained within the vial of "NFAT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.