Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-MMP3 Polyclonal Antibody – Cat# AAA199037 – Application Data Application Data (Equine Cartilage ExplantsMMP3 antibody - middle region (AAA199037) validated by WB using Equine Cartilage Explants at 1:1000.)

Stromelysin-1 Preproprotein (MMP3) Antibody – Rabbit Polyclonal

MMP3 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
MMP3; SL-1; STMY; STR1; CHDS6; MMP-3; STMY1
Reactivity
Tested Species Reactibity: Human, Horse
Predicted Sepcies Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
MMP3, Antibody; MMP3 antibody - middle region; anti-MMP3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Species Reactibity: Human, Horse
Predicted Sepcies Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN
Sequence Length
477
Applicable Applications for anti-MMP3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MMP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Application Data

(Equine Cartilage ExplantsMMP3 antibody - middle region (AAA199037) validated by WB using Equine Cartilage Explants at 1:1000.)

Rabbit Anti-MMP3 Polyclonal Antibody – Cat# AAA199037 – Application Data Application Data (Equine Cartilage ExplantsMMP3 antibody - middle region (AAA199037) validated by WB using Equine Cartilage Explants at 1:1000.)

Application Data

(Equine Cartilage ExplantsSample Type: Equine Cartilage ExplantsPrimary Dilution: 1:1000Secondary: Abcam ab97200 (Dilution: 1:20,000).)

Rabbit Anti-MMP3 Polyclonal Antibody – Cat# AAA199037 – Application Data Application Data (Equine Cartilage ExplantsSample Type: Equine Cartilage ExplantsPrimary Dilution: 1:1000Secondary: Abcam ab97200 (Dilution: 1:20,000).)

IHC (Immunohiostchemistry)

(Sample Type: Human colorectal cancerApplication: IHCSpecies+tissue/cell type: Control-Human small intestine, Sample-human colorectal cancerPrimary antibody dilution: 1:100Secondary antibody: Biotinylated pig anti-rabbit+streptavidin-HRP)

Rabbit Anti-MMP3 Polyclonal Antibody – Cat# AAA199037 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Sample Type: Human colorectal cancerApplication: IHCSpecies+tissue/cell type: Control-Human small intestine, Sample-human colorectal cancerPrimary antibody dilution: 1:100Secondary antibody: Biotinylated pig anti-rabbit+streptavidin-HRP)

WB (Western Blot)

(WB Suggested Anti-MMP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate.)

Rabbit Anti-MMP3 Polyclonal Antibody – Cat# AAA199037 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-MMP3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate.)
Related Product Information for anti-MMP3 antibody
This is a rabbit polyclonal antibody against MMP3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MMP3 can degrade fibronectin, laminin, gelatins of type I, III, IV, and V; collagens III, IV, X, and IX, and cartilage proteoglycans. MMP3 activates procollagenase.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
stromelysin-1 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 3
NCBI Official Symbol
MMP3
NCBI Official Synonym Symbols
SL-1; STMY; STR1; CHDS6; MMP-3; STMY1
NCBI Protein Information
stromelysin-1
UniProt Protein Name
Stromelysin-1
UniProt Gene Name
MMP3
UniProt Synonym Gene Names
STMY1; SL-1; MMP-3
UniProt Entry Name
MMP3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The MMP3 mmp3 (Catalog #AAA199037) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP3 antibody - middle region reacts with Tested Species Reactibity: Human, Horse Predicted Sepcies Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MMP3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MMP3 mmp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEDFPGIDSK IDAVFEEFGF FYFFTGSSQL EFDPNAKKVT HTLKSNSWLN. It is sometimes possible for the material contained within the vial of "MMP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.