Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-LCAT Polyclonal Antibody – Cat# AAA198965 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-LCAT Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

Phosphatidylcholine-Sterol Acyltransferase (LCAT) Antibody – Rabbit Polyclonal

LCAT antibody - C-terminal region

Average rating 0.0
No ratings yet
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
LCAT, Antibody; LCAT antibody - C-terminal region; anti-LCAT antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL
Sequence Length
440
Applicable Applications for anti-LCAT antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human LCAT
Protein Size (# AA)
440 amino acids
Protein Interactions
APOA1; EXOSC10; APOE; APOA2; A2M;
Blocking Peptide
For anti-LCAT (MBS3205984) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-LCAT Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

Rabbit Anti-LCAT Polyclonal Antibody – Cat# AAA198965 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-LCAT Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

WB (Western Blot)

(Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit Anti-LCAT Polyclonal Antibody – Cat# AAA198965 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Rabbit Anti-LCAT Polyclonal Antibody – Cat# AAA198965 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: NOP56Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Rabbit Anti-LCAT Polyclonal Antibody – Cat# AAA198965 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(LCAT antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-LCAT Polyclonal Antibody – Cat# AAA198965 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (LCAT antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-LCAT antibody
This is a rabbit polyclonal antibody against LCAT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LCAT is an extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in its gene have been found to cause fish-eye disease as well as LCAT deficiency.This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency.This gene encodes the extracellular cholesterol esterifying enzyme, lecithin-cholesterol acyltransferase. The esterification of cholesterol is required for cholesterol transport. Mutations in this gene have been found to cause fish-eye disease as well as LCAT deficiency. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
phosphatidylcholine-sterol acyltransferase
NCBI Official Synonym Full Names
lecithin-cholesterol acyltransferase
NCBI Official Symbol
LCAT
NCBI Protein Information
phosphatidylcholine-sterol acyltransferase
UniProt Protein Name
Phosphatidylcholine-sterol acyltransferase
UniProt Gene Name
LCAT
UniProt Entry Name
LCAT_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The LCAT lcat (Catalog #AAA198965) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LCAT antibody - C-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LCAT can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the LCAT lcat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVLYEDGDDT VATRSTELCG LWQGRQPQPV HLLPLHGIQH LNMVFSNLTL. It is sometimes possible for the material contained within the vial of "LCAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.