Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-HSF2 Polyclonal Antibody – Cat# AAA201802 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HSF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateHSF2 is supported by BioGPS gene expression data to be expressed in 721_B)

Heat Shock Factor Protein 2 Isoform A (HSF2) Antibody – Rabbit Polyclonal

HSF2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
HSF2; HSF 2; HSTF 2
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HSF2, Antibody; HSF2 antibody - middle region; anti-HSF2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSVQMNPTDYINNTKSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQY
Sequence Length
536
Applicable Applications for anti-HSF2 antibody
WB (Western Blot)
Homology
Cow: 92%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HSF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HSF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateHSF2 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit Anti-HSF2 Polyclonal Antibody – Cat# AAA201802 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HSF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateHSF2 is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Host: MouseTarget Name: HSF2Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit Anti-HSF2 Polyclonal Antibody – Cat# AAA201802 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: HSF2Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-HSF2 antibody
This is a rabbit polyclonal antibody against HSF2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HSF2 binds specifically to the heat-shock element and has homology to HSFs of other species. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Although the names HSF1 and HSF2 were chosen for historical reasons, these peptides should be referred to as heat-shock transcription factors.HSF2, as well as the related gene HSF1, encodes a protein that binds specifically to the heat-shock element and has homology to HSFs of other species. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Although the names HSF1 and HSF2 were chosen for historical reasons, these peptides should be referred to as heat-shock transcription factors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-HSF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
heat shock factor protein 2 isoform a
NCBI Official Synonym Full Names
heat shock transcription factor 2
NCBI Official Symbol
HSF2
NCBI Official Synonym Symbols
HSF 2; HSTF 2
NCBI Protein Information
heat shock factor protein 2
UniProt Protein Name
Heat shock factor protein 2
UniProt Gene Name
HSF2
UniProt Synonym Gene Names
HSTF2; HSF 2; HSTF 2
UniProt Entry Name
HSF2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The HSF2 hsf2 (Catalog #AAA201802) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSF2 antibody - middle region reacts with Cow, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HSF2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HSF2 hsf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSVQMNPTDY INNTKSENKG LETTKNNVVQ PVSEEGRKSK SKPDKQLIQY. It is sometimes possible for the material contained within the vial of "HSF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.