Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-HSD11B1 Polyclonal Antibody – Cat# AAA199603 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HSD11B1 Antibody Titration: 2 ug/mlPositive Control: Transient overexpression lysate of HSD11B1 and Non-overexpressed vector control lysate)

Corticosteroid 11-Beta-Dehydrogenase Isozyme 1 (HSD11B1) Antibody – Rabbit Polyclonal

HSD11B1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HSD11B1; HDL; 11-DH; HSD11; HSD11B; HSD11L; CORTRD2; SDR26C1; 11-beta-HSD1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
HSD11B1, Antibody; HSD11B1 antibody - N-terminal region; anti-HSD11B1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
Sequence Length
292
Applicable Applications for anti-HSD11B1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HSD11B1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HSD11B1 Antibody Titration: 2 ug/mlPositive Control: Transient overexpression lysate of HSD11B1 and Non-overexpressed vector control lysate)

Rabbit Anti-HSD11B1 Polyclonal Antibody – Cat# AAA199603 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HSD11B1 Antibody Titration: 2 ug/mlPositive Control: Transient overexpression lysate of HSD11B1 and Non-overexpressed vector control lysate)

WB (Western Blot)

(WB Suggested Anti-HSD11B1 Antibody Titration: 1 ug/mlPositive Control: Fetal liver cell lysate)

Rabbit Anti-HSD11B1 Polyclonal Antibody – Cat# AAA199603 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-HSD11B1 Antibody Titration: 1 ug/mlPositive Control: Fetal liver cell lysate)

WB (Western Blot)

(Host: RatTarget Name: HSD11B1Sample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

Rabbit Anti-HSD11B1 Polyclonal Antibody – Cat# AAA199603 – WB (Western Blot) WB (Western Blot) (Host: RatTarget Name: HSD11B1Sample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-HSD11B1 antibody)

Rabbit Anti-HSD11B1 Polyclonal Antibody – Cat# AAA199603 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-HSD11B1 antibody)
Related Product Information for anti-HSD11B1 antibody
This is a rabbit polyclonal antibody against HSD11B1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
corticosteroid 11-beta-dehydrogenase isozyme 1
NCBI Official Synonym Full Names
hydroxysteroid 11-beta dehydrogenase 1
NCBI Official Symbol
HSD11B1
NCBI Official Synonym Symbols
HDL; 11-DH; HSD11; HSD11B; HSD11L; CORTRD2; SDR26C1; 11-beta-HSD1
NCBI Protein Information
corticosteroid 11-beta-dehydrogenase isozyme 1
UniProt Protein Name
Corticosteroid 11-beta-dehydrogenase isozyme 1
UniProt Gene Name
HSD11B1
UniProt Synonym Gene Names
HSD11; HSD11L; 11-DH
UniProt Entry Name
DHI1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The HSD11B1 hsd11b1 (Catalog #AAA199603) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD11B1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's HSD11B1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HSD11B1 hsd11b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QKVVSHCLEL GAASAHYIAG TMEDMTFAEQ FVAQAGKLMG GLDMLILNHI. It is sometimes possible for the material contained within the vial of "HSD11B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.