Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-GRN Polyclonal Antibody – Cat# AAA200392 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: GRNSample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

Granulin (GRN) Antibody – Rabbit Polyclonal

GRN Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
GRN; GEP; GP88; PEPI; PGRN; CLN11; PCDGF
Reactivity
Cow, Dog, Horse, Human, Rabbit
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GRN, Antibody; GRN Antibody - middle region; anti-GRN antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGD
Sequence Length
438
Applicable Applications for anti-GRN antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Rabbit: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human GRN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: GRNSample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Anti-GRN Polyclonal Antibody – Cat# AAA200392 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: GRNSample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-GRN AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-GRN Polyclonal Antibody – Cat# AAA200392 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-GRN AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-GRN antibody
This is a rabbit polyclonal antibody against GRN. It was validated on Western Blot

Target Description: Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis.
Product Categories/Family for anti-GRN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
granulin
NCBI Official Synonym Full Names
granulin precursor
NCBI Official Symbol
GRN
NCBI Official Synonym Symbols
GEP; GP88; PEPI; PGRN; CLN11; PCDGF
NCBI Protein Information
progranulin; granulins
UniProt Protein Name
Granulins
UniProt Gene Name
GRN
UniProt Synonym Gene Names
PEPI
UniProt Entry Name
GRN_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The GRN grn (Catalog #AAA200392) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRN Antibody - middle region reacts with Cow, Dog, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's GRN can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GRN grn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPMPNATCCS DHLHCCPQDT VCDLIQSKCL SKENATTDLL TKLPAHTVGD. It is sometimes possible for the material contained within the vial of "GRN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.