Glycoprotein (glycoprotein) Antibody – Rabbit Polyclonal
Glycoprotein antibody
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
Glycoprotein, Antibody; Glycoprotein antibody; Polyclonal Glycoprotein; Anti-Glycoprotein; NMB; HGFIN; GPNMB; Transmembrane Nmb; anti-glycoprotein antibody
Product Overview
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPNMB antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
507
Applicable Applications for anti-glycoprotein antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential.
Cross-Reactivity
Human,Mouse
Immunogen
Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-glycoprotein antibody
Rabbit polyclonal Glycoprotein antibody
Product Categories/Family for anti-glycoprotein antibody
NCBI and Uniprot Product Information
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The Glycoprotein glycoprotein (Catalog #AAA108358) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Glycoprotein antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Glycoprotein can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the Glycoprotein glycoprotein for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Glycoprotein, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
