Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23458_WB6.jpg WB (Western Blot) (WB Suggested Anti-GJC2 antibody Titration: 1 ug/mLSample Type: Human liver)

Rabbit GJC2 Polyclonal Antibody | anti-GJC2 antibody

GJC2 antibody - middle region

Gene Names
GJC2; Cx47; HLD2; GJA12; SPG44; CX46.6; LMPH1C; LMPHM3; PMLDAR
Reactivity
Human, Rabbit
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GJC2, Antibody; GJC2 antibody - middle region; anti-GJC2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW
Sequence Length
439
Applicable Applications for anti-GJC2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GJC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GJC2 antibody Titration: 1 ug/mLSample Type: Human liver)

product-image-AAA23458_WB6.jpg WB (Western Blot) (WB Suggested Anti-GJC2 antibody Titration: 1 ug/mLSample Type: Human liver)

WB (Western Blot)

(WB Suggested Anti-GJC2 antibody Titration: 1 ug/mLSample Type: Human heart)

product-image-AAA23458_WB5.jpg WB (Western Blot) (WB Suggested Anti-GJC2 antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(WB Suggested Anti-GJC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

product-image-AAA23458_WB4.jpg WB (Western Blot) (WB Suggested Anti-GJC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: GJC2Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

product-image-AAA23458_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: GJC2Sample Type: MCF7Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GJC2Sample Type: 293TAntibody Dilution: 1.0ug/mlGJC2 is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA23458_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: GJC2Sample Type: 293TAntibody Dilution: 1.0ug/mlGJC2 is supported by BioGPS gene expression data to be expressed in HEK293T)

IHC (Immunohistochemistry)

(Rabbit Anti-GJC2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Membrane, some cytoplasmPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA23458_IHC.jpg IHC (Immunohistochemistry) (Rabbit Anti-GJC2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Membrane, some cytoplasmPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-GJC2 antibody
This is a rabbit polyclonal antibody against GJC2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.This gene encodes a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.
Product Categories/Family for anti-GJC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
gap junction gamma-2 protein
NCBI Official Synonym Full Names
gap junction protein gamma 2
NCBI Official Symbol
GJC2
NCBI Official Synonym Symbols
Cx47; HLD2; GJA12; SPG44; CX46.6; LMPH1C; LMPHM3; PMLDAR
NCBI Protein Information
gap junction gamma-2 protein
UniProt Protein Name
Gap junction gamma-2 protein
UniProt Gene Name
GJC2
UniProt Synonym Gene Names
GJA12; Cx46.6; Cx47
UniProt Entry Name
CXG2_HUMAN

Similar Products

Product Notes

The GJC2 gjc2 (Catalog #AAA23458) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GJC2 antibody - middle region reacts with Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's GJC2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GJC2 gjc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APASRTGSAT SAGTVGEQGR PGTHERPGAK PRAGSEKGSA SSRDGKTTVW. It is sometimes possible for the material contained within the vial of "GJC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.