Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-FYN Polyclonal Antibody – Cat# AAA200515 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FYN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human heart)

Tyrosine-Protein Kinase Fyn Isoform C (FYN) Antibody – Rabbit Polyclonal

FYN antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
FYN; SLK; SYN; p59-FYN
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FYN, Antibody; FYN antibody - N-terminal region; anti-FYN antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN
Sequence Length
482
Applicable Applications for anti-FYN antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FYN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FYN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human heart)

Rabbit Anti-FYN Polyclonal Antibody – Cat# AAA200515 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FYN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human heart)

WB (Western Blot)

(Host: RabbitTarget Name: FYNSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-FYN Polyclonal Antibody – Cat# AAA200515 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: FYNSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FYNSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Rabbit Anti-FYN Polyclonal Antibody – Cat# AAA200515 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: FYNSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FYNSample Type: 293TAntibody Dilution: 1.0ug/mlFYN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit Anti-FYN Polyclonal Antibody – Cat# AAA200515 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: FYNSample Type: 293TAntibody Dilution: 1.0ug/mlFYN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

IHC (Immunohistochemistry)

(Rabbit Anti-FYN AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: Cytoplasm, Plasma membrane, NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-FYN Polyclonal Antibody – Cat# AAA200515 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-FYN AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: Cytoplasm, Plasma membrane, NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-FYN antibody
This is a rabbit polyclonal antibody against FYN. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
tyrosine-protein kinase Fyn isoform c
NCBI Official Synonym Full Names
FYN proto-oncogene, Src family tyrosine kinase
NCBI Official Symbol
FYN
NCBI Official Synonym Symbols
SLK; SYN; p59-FYN
NCBI Protein Information
tyrosine-protein kinase Fyn
UniProt Protein Name
Tyrosine-protein kinase Fyn
UniProt Gene Name
FYN
UniProt Synonym Gene Names
SLK
UniProt Entry Name
FYN_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The FYN fyn (Catalog #AAA200515) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FYN antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FYN can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FYN fyn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GCVQCKDKEA TKLTEERDGS LNQSSGYRYG TDPTPQHYPS FGVTSIPNYN. It is sometimes possible for the material contained within the vial of "FYN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.