Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-DES Polyclonal Antibody – Cat# AAA198925 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-DES Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Desmin (DES) Antibody – Rabbit Polyclonal

DES antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
DES; CSM1; CSM2; CDCD3; CMD1F; LGMD1D; LGMD1E; LGMD2R
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DES, Antibody; DES antibody - middle region; anti-DES antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT
Sequence Length
470
Applicable Applications for anti-DES antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DES
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DES Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Rabbit Anti-DES Polyclonal Antibody – Cat# AAA198925 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-DES Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

WB (Western Blot)

(Host: RabbitTarget Name: DESSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-DES Polyclonal Antibody – Cat# AAA198925 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: DESSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: DESSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Rabbit Anti-DES Polyclonal Antibody – Cat# AAA198925 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: DESSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: DESSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit Anti-DES Polyclonal Antibody – Cat# AAA198925 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: DESSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-DES antibody
This is a rabbit polyclonal antibody against DES. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.This gene encodes a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-DES antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
desmin
NCBI Official Synonym Full Names
desmin
NCBI Official Symbol
DES
NCBI Official Synonym Symbols
CSM1; CSM2; CDCD3; CMD1F; LGMD1D; LGMD1E; LGMD2R
NCBI Protein Information
desmin
UniProt Protein Name
Desmin
UniProt Gene Name
DES
UniProt Entry Name
DESM_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The DES des (Catalog #AAA198925) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DES antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DES can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DES des for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MALDVEIATY RKLLEGEESR INLPIQTYSA LNFRETSPEQ RGSEVHTKKT. It is sometimes possible for the material contained within the vial of "DES, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.