Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CYP2D6 Polyclonal Antibody – Cat# AAA124578 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Figure 5. IHC analysis of Cytochrome P450 2D6 using anti- Cytochrome P450 2D6 antibody (AAA124578).Cytochrome P450 2D6 was detected in paraffin-embedded section of human liver cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- Cytochrome P450 2D6 Antibody (AAA124578) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

Cytochrome P450 2D6 Isoform 1 (CYP2D6) Antibody – Rabbit Polyclonal

Anti-Cytochrome P450 2D6 Picoband Antibody

Average rating 0.0
No ratings yet
Gene Names
CYP2D6; CPD6; CYP2D; CYP2DL1; CYPIID6; P450C2D; P450DB1; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; P450-DB1
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified
Synonyms
Cytochrome P450 2D6, Antibody; Anti-Cytochrome P450 2D6 Picoband Antibody; Cytochrome P450 2D6; 1.14.14.1; CYPIID6; Cytochrome P450-DB1; Debrisoquine 4-hydroxylase; CYP2D6; CYP2DL1; anti-CYP2D6 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins
Clonality
Polyclonal
Purity/Purification
Immunogen affinity purified
Form/Format
Lyophilized
Concentration
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. (varies by lot)
Sequence Length
446
Applicable Applications for anti-CYP2D6 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM).
Subcellular Localization
Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Figure 5. IHC analysis of Cytochrome P450 2D6 using anti- Cytochrome P450 2D6 antibody (AAA124578).Cytochrome P450 2D6 was detected in paraffin-embedded section of human liver cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- Cytochrome P450 2D6 Antibody (AAA124578) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

Rabbit Anti-CYP2D6 Polyclonal Antibody – Cat# AAA124578 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Figure 5. IHC analysis of Cytochrome P450 2D6 using anti- Cytochrome P450 2D6 antibody (AAA124578).Cytochrome P450 2D6 was detected in paraffin-embedded section of human liver cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- Cytochrome P450 2D6 Antibody (AAA124578) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemistry)

(Figure 4. IHC analysis of Cytochrome P450 2D6 using anti- Cytochrome P450 2D6 antibody (AAA124578).Cytochrome P450 2D6 was detected in paraffin-embedded section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- Cytochrome P450 2D6 Antibody (AAA124578) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

Rabbit Anti-CYP2D6 Polyclonal Antibody – Cat# AAA124578 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Figure 4. IHC analysis of Cytochrome P450 2D6 using anti- Cytochrome P450 2D6 antibody (AAA124578).Cytochrome P450 2D6 was detected in paraffin-embedded section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- Cytochrome P450 2D6 Antibody (AAA124578) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohistochemisry)

(Figure 3. IHC analysis of Cytochrome P450 2D6 using anti- Cytochrome P450 2D6 antibody (AAA124578).Cytochrome P450 2D6 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- Cytochrome P450 2D6 Antibody (AAA124578) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

Rabbit Anti-CYP2D6 Polyclonal Antibody – Cat# AAA124578 – IHC (Immunohistochemisry) IHC (Immunohistochemisry) (Figure 3. IHC analysis of Cytochrome P450 2D6 using anti- Cytochrome P450 2D6 antibody (AAA124578).Cytochrome P450 2D6 was detected in paraffin-embedded section of mouse liver tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- Cytochrome P450 2D6 Antibody (AAA124578) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohiostchemistry)

(Figure 2. IHC analysis of Cytochrome P450 2D6 using anti- Cytochrome P450 2D6 antibody (AAA124578).Cytochrome P450 2D6 was detected in paraffin-embedded section of mouse intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- Cytochrome P450 2D6 Antibody (AAA124578) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

Rabbit Anti-CYP2D6 Polyclonal Antibody – Cat# AAA124578 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Figure 2. IHC analysis of Cytochrome P450 2D6 using anti- Cytochrome P450 2D6 antibody (AAA124578).Cytochrome P450 2D6 was detected in paraffin-embedded section of mouse intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- Cytochrome P450 2D6 Antibody (AAA124578) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of Cytochrome P450 2D6 using anti- Cytochrome P450 2D6 antibody (AAA124578).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat liver tissue lysates,Lane 2: mouse liver tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- Cytochrome P450 2D6 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Cytochrome P450 2D6 at approximately 56KD. The expected band size for Cytochrome P450 2D6 is at 56KD.)

Rabbit Anti-CYP2D6 Polyclonal Antibody – Cat# AAA124578 – WB (Western Blot) WB (Western Blot) (Figure 1. Western blot analysis of Cytochrome P450 2D6 using anti- Cytochrome P450 2D6 antibody (AAA124578).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat liver tissue lysates,Lane 2: mouse liver tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- Cytochrome P450 2D6 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Cytochrome P450 2D6 at approximately 56KD. The expected band size for Cytochrome P450 2D6 is at 56KD.)
Related Product Information for anti-CYP2D6 antibody
Description: Cytochrome P450 2D6 (CYP2D6) is one of the most important enzymes involved in the metabolism of xenobiotics in the body. It is a member of Cytochrome P450, family 2, subfamily D, polypeptide 6. This gene is mapped to chromosome 22q13.1. It has got 497 amino acid proteins which shares 73% sequence identity with the rat protein. CYP2D6 is highly expressed in human liver and it is the major isozyme involved in the formation of N-hydroxyprocainamide, a metabolite potentially involved in the drug-induced lupus syndrome observed with procainamide.
Protein Function: Responsible for the metabolism of many drugs and environmental chemicals that it oxidizes. It is involved in the metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55769 MW
NCBI Official Full Name
cytochrome P450 2D6 isoform 1
NCBI Official Synonym Full Names
cytochrome P450 family 2 subfamily D member 6
NCBI Official Symbol
CYP2D6
NCBI Official Synonym Symbols
CPD6; CYP2D; CYP2DL1; CYPIID6; P450C2D; P450DB1; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; P450-DB1
NCBI Protein Information
cytochrome P450 2D6
UniProt Protein Name
Cytochrome P450 2D6
UniProt Gene Name
CYP2D6
UniProt Synonym Gene Names
CYP2DL1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CYP2D6 cyp2d6 (Catalog #AAA124578) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Cytochrome P450 2D6 Picoband Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins and may cross-react with other species as described in the data sheet. AAA Biotech's Cytochrome P450 2D6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CYP2D6 cyp2d6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cytochrome P450 2D6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.