Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CRKL Polyclonal Antibody – Cat# AAA197105 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CRKL AntibodyTitration: 1.0 ug/mlPositive Control: K562 Whole CellCRKL is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells)

Crk-Like Protein (CRKL) Antibody – Rabbit Polyclonal

CRKL Antibody - middle region

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CRKL, Antibody; CRKL Antibody - middle region; anti-CRKL antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS
Sequence Length
303
Applicable Applications for anti-CRKL antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human CRKL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CRKL AntibodyTitration: 1.0 ug/mlPositive Control: K562 Whole CellCRKL is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells)

Rabbit Anti-CRKL Polyclonal Antibody – Cat# AAA197105 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CRKL AntibodyTitration: 1.0 ug/mlPositive Control: K562 Whole CellCRKL is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells)

IHC (Immunohiostchemistry)

(Rabbit Anti-CRKL AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: Plasma membrane, CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-CRKL Polyclonal Antibody – Cat# AAA197105 – IHC (Immunohiostchemistry) IHC (Immunohiostchemistry) (Rabbit Anti-CRKL AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: Plasma membrane, CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Rabbit Anti-CRKL AntibodyParaffin Embedded Tissue: Human Lung cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-CRKL Polyclonal Antibody – Cat# AAA197105 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-CRKL AntibodyParaffin Embedded Tissue: Human Lung cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-CRKL antibody
This is a rabbit polyclonal antibody against CRKL. It was validated on Western Blot

Target Description: CRKL has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase and plays a role in fibroblast transformation by BCR-ABL. In addition, CRKL has oncogenic potential.
Product Categories/Family for anti-CRKL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
crk-like protein
NCBI Official Synonym Full Names
CRK like proto-oncogene, adaptor protein
NCBI Official Symbol
CRKL
NCBI Protein Information
crk-like protein
UniProt Protein Name
Crk-like protein
UniProt Gene Name
CRKL
UniProt Entry Name
CRKL_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CRKL crkl (Catalog #AAA197105) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRKL Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRKL can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CRKL crkl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSSPHGKHGN RNSNSYGIPE PAHAYAQPQT TTPLPAVSGS PGAAITPLPS. It is sometimes possible for the material contained within the vial of "CRKL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.