Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200980_WB13.jpg WB (Western Blot) (WB Suggested Anti-COL1A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Rabbit COL1A1 Polyclonal Antibody | anti-COL1A1 antibody

COL1A1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
COL1A1; OI1; OI2; OI3; OI4; EDSC; EDSARTH1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COL1A1, Antibody; COL1A1 antibody - C-terminal region; anti-COL1A1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC
Sequence Length
1464
Applicable Applications for anti-COL1A1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human COL1A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-COL1A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

product-image-AAA200980_WB13.jpg WB (Western Blot) (WB Suggested Anti-COL1A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

IHC (Immunohistochemistry)

(Rabbit Anti-COL1A1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA200980_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-COL1A1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-COL1A1 antibody
This is a rabbit polyclonal antibody against COL1A1. It was validated on Western Blot

Target Description: This gene encodes the pro-alpha1 chains of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIA, Ehlers-Danlos syndrome Classical type, Caffey Disease and idiopathic osteoporosis. Reciprocal translocations between chromosomes 17 and 22, where this gene and the gene for platelet-derived growth factor beta are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans, resulting from unregulated expression of the growth factor. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
137kDa
NCBI Official Full Name
collagen alpha-1(I) chain preproprotein
NCBI Official Synonym Full Names
collagen type I alpha 1 chain
NCBI Official Symbol
COL1A1
NCBI Official Synonym Symbols
OI1; OI2; OI3; OI4; EDSC; EDSARTH1
NCBI Protein Information
collagen alpha-1(I) chain
UniProt Protein Name
Collagen alpha-1(I) chain
UniProt Gene Name
COL1A1
UniProt Entry Name
CO1A1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The COL1A1 col1a1 (Catalog #AAA200980) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COL1A1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's COL1A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the COL1A1 col1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YRADDANVVR DRDLEVDTTL KSLSQQIENI RSPEGSRKNP ARTCRDLKMC. It is sometimes possible for the material contained within the vial of "COL1A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.