Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CD5 Polyclonal Antibody – Cat# AAA124577 – FCM/FACS (Flow Cytometry) FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of PBMC cells using anti-CD5 antibody (AAA124577).Overlay histogram showing PBMC cells stained with AAA124577 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CD5 Antibody (AAA124577,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

T-Cell Surface Glycoprotein CD5 Isoform 2 (CD5) Antibody – Rabbit Polyclonal

Anti-CD5 Picoband antibody

Average rating 0.0
No ratings yet
Gene Names
CD5; T1; LEU1
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Western Blot, Immunocytochemistry, Immunohistochemistry, Flow Cytometry, Functional Assay
Synonyms
CD5, Antibody; Anti-CD5 Picoband antibody; T-cell surface glycoprotein CD5; Lymphocyte antigen T1/Leu-1; CD5; LEU1; anti-CD5 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Form/Format
Lyophilized
Sequence Length
495
Applicable Applications for anti-CD5 antibody
WB (Western Blot), ICC (Immunocytochemistry), IHC (Immunohistochemistry), FCM/FACS (Flow Cytometry)
Immunogen
A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH).
Subcellular Localization
Cell membrane; Single-pass type I membrane protein.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 2. Flow Cytometry analysis of PBMC cells using anti-CD5 antibody (AAA124577).Overlay histogram showing PBMC cells stained with AAA124577 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CD5 Antibody (AAA124577,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit Anti-CD5 Polyclonal Antibody – Cat# AAA124577 – FCM/FACS (Flow Cytometry) FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of PBMC cells using anti-CD5 antibody (AAA124577).Overlay histogram showing PBMC cells stained with AAA124577 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-CD5 Antibody (AAA124577,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

WB (Western Blot)

(Figure 1. Western blot analysis of CD5 using anti-CD5 antibody (AAA124577).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat liver tissue lysates,Lane 2: mouse HEPA1-6 cell lysates,Lane 3: human Hela cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CD5 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CD5 at approximately 67KD. The expected band size for CD5 is at 54KD.)

Rabbit Anti-CD5 Polyclonal Antibody – Cat# AAA124577 – WB (Western Blot) WB (Western Blot) (Figure 1. Western blot analysis of CD5 using anti-CD5 antibody (AAA124577).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: rat liver tissue lysates,Lane 2: mouse HEPA1-6 cell lysates,Lane 3: human Hela cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CD5 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CD5 at approximately 67KD. The expected band size for CD5 is at 54KD.)
Related Product Information for anti-CD5 antibody
Description: CD5 is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. In humans, the gene is located on the long arm of chromosome 11. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein Function: May act as a receptor in regulating T-cell proliferation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
921
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,578 Da
NCBI Official Full Name
T-cell surface glycoprotein CD5 isoform 2
NCBI Official Synonym Full Names
CD5 molecule
NCBI Official Symbol
CD5
NCBI Official Synonym Symbols
T1; LEU1
NCBI Protein Information
T-cell surface glycoprotein CD5
UniProt Protein Name
T-cell surface glycoprotein CD5
UniProt Gene Name
CD5
UniProt Synonym Gene Names
LEU1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CD5 cd5 (Catalog #AAA124577) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CD5 Picoband antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's CD5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ICC (Immunocytochemistry), IHC (Immunohistochemistry), FCM/FACS (Flow Cytometry). Researchers should empirically determine the suitability of the CD5 cd5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.