Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-CCKAR Polyclonal Antibody – Cat# AAA201262 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CCKAR AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Cholecystokinin Receptor Type A (CCKAR) Antibody – Rabbit Polyclonal

CCKAR antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CCKAR; CCK-A; CCK1R; CCKRA; CCK1-R
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCKAR, Antibody; CCKAR antibody - C-terminal region; anti-CCKAR antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKLELRQLSTGSSS
Sequence Length
428
Applicable Applications for anti-CCKAR antibody
WB (Western Blot)
Homology
Cow: 79%; Guinea Pig: 79%; Horse: 83%; Human: 100%; Rabbit: 86%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CCKAR AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit Anti-CCKAR Polyclonal Antibody – Cat# AAA201262 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-CCKAR AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

WB (Western Blot)

(Host: RabbitTarget Name: CCKARSample Type: Human LiverLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)

Rabbit Anti-CCKAR Polyclonal Antibody – Cat# AAA201262 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: CCKARSample Type: Human LiverLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)
Related Product Information for anti-CCKAR antibody
This is a rabbit polyclonal antibody against CCKAR. It was validated on Western Blot

Target Description: This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine.
Product Categories/Family for anti-CCKAR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
886
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
cholecystokinin receptor type A
NCBI Official Synonym Full Names
cholecystokinin A receptor
NCBI Official Symbol
CCKAR
NCBI Official Synonym Symbols
CCK-A; CCK1R; CCKRA; CCK1-R
NCBI Protein Information
cholecystokinin receptor type A
UniProt Protein Name
Cholecystokinin receptor type A
UniProt Gene Name
CCKAR
UniProt Synonym Gene Names
CCKRA; CCK-A receptor; CCK-AR; CCK1-R
UniProt Entry Name
CCKAR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The CCKAR cckar (Catalog #AAA201262) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCKAR antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCKAR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CCKAR cckar for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FEASQKKSAK ERKPSTTSSG KYEDSDGCYL QKTRPPRKLE LRQLSTGSSS. It is sometimes possible for the material contained within the vial of "CCKAR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.