Peroxisomal Coenzyme A Diphosphatase NUDT7 Isoform 3 (Nudt7) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Mouse Peroxisomal coenzyme A diphosphatase NUDT7 (Nudt7)
Gene Names
Nudt7; 1300007B24Rik; 2210404C19Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peroxisomal coenzyme A diphosphatase NUDT7 (Nudt7); N/A; Recombinant Mouse Peroxisomal coenzyme A diphosphatase NUDT7 (Nudt7); Nudt7 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-236aa; Full Length
Sequence
MSRPCGLPEPVRNNLIDDAKARLRKSDVGTRYSHLSSNKFSVLVPLLARGGKLYLMFTVRSDKLKREPGEVCFPGGKRDPVDTDDTATALREAQEEVGLHPHQVEVVSHLVPYVFDNDALVTPVVGFLDHNFQAQPNADEVKEVFFVPLDYFLHPQVYYQKQITQSGRDFIMHCFEYKDPETGVNYLIQGMTSKLAVLVALIILEQSPAFKIDFDLHDLIPSCERTFLWRYSLSKL
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Nudt7 recombinant protein
This protein is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. Alternatively spliced transcript variants have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
18,648 Da
NCBI Official Full Name
peroxisomal coenzyme A diphosphatase NUDT7 isoform 3
NCBI Official Synonym Full Names
nudix (nucleoside diphosphate linked moiety X)-type motif 7
NCBI Official Symbol
Nudt7
NCBI Official Synonym Symbols
1300007B24Rik; 2210404C19Rik
NCBI Protein Information
peroxisomal coenzyme A diphosphatase NUDT7
UniProt Protein Name
Peroxisomal coenzyme A diphosphatase NUDT7
UniProt Gene Name
Nudt7
UniProt Synonym Gene Names
Nudix motif 7
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The Nudt7 nudt7 (Catalog #AAA116631) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-236aa; Full Length. The amino acid sequence is listed below: MSRPCGLPEP VRNNLIDDAK ARLRKSDVGT RYSHLSSNKF SVLVPLLARG GKLYLMFTVR SDKLKREPGE VCFPGGKRDP VDTDDTATAL REAQEEVGLH PHQVEVVSHL VPYVFDNDAL VTPVVGFLDH NFQAQPNADE VKEVFFVPLD YFLHPQVYYQ KQITQSGRDF IMHCFEYKDP ETGVNYLIQG MTSKLAVLVA LIILEQSPAF KIDFDLHDLI PSCERTFLWR YSLSKL. It is sometimes possible for the material contained within the vial of "Peroxisomal coenzyme A diphosphatase NUDT7 (Nudt7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.