Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18673_SDS_PAGE.jpg SDS-PAGE

Nucleoprotein Recombinant Protein | NP recombinant protein

Recombinant Zaire ebolavirus Nucleoprotein (NP), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nucleoprotein; N/A; Recombinant Zaire ebolavirus Nucleoprotein (NP), partial; Nucleocapsid protein; Protein N; NP recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
488-739aa; Partial
Sequence
LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18673_SDS_PAGE.jpg SDS-PAGE
Related Product Information for NP recombinant protein
Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. During replication, encapsidation by NP is coupled to RNA synthesis and all replicative products are resistant to nucleases.
References
The nucleoprotein gene of Ebola virus cloning, sequencing, and in vitro expression.Sanchez A., Kiley M.P., Holloway B.P., McCormick J.B., Auperin D.D.Virology 170:81-91(1989) Sequence analysis of the Ebola virus genome organization, genetic elements, and comparison with the genome of Marburg virus.Sanchez A., Kiley M.P., Holloway B.P., Auperin D.D.Virus Res. 29:215-240(1993) Molecular characterization of guinea pig-adapted variants of Ebola virus.Volchkov V.E., Chepurnov A.A., Volchkova V.A., Ternovoj V.A., Klenk H.D.Virology 277:147-155(2000) Wilson J.A., Kondig J.P., Kuehne A.I., Hart M.K. The assembly of Ebola virus nucleocapsid requires virion-associated proteins 35 and 24 and posttranslational modification of nucleoprotein.Huang Y., Xu L., Sun Y., Nabel G.J.Mol. Cell 10:307-316(2002) Functional mapping of the nucleoprotein of Ebola virus.Watanabe S., Noda T., Kawaoka Y.J. Virol. 80:3743-3751(2006) Mapping of the VP40-binding regions of the nucleoprotein of Ebola virus.Noda T., Watanabe S., Sagara H., Kawaoka Y.J. Virol. 81:3554-3562(2007)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31.1 kDa
NCBI Official Full Name
nucleoprotein
NCBI Official Symbol
NP
NCBI Protein Information
nucleoprotein
UniProt Protein Name
Nucleoprotein
UniProt Gene Name
NP
UniProt Synonym Gene Names
Protein N
UniProt Entry Name
NCAP_EBOZM

Similar Products

Product Notes

The NP np (Catalog #AAA18673) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 488-739aa; Partial. The amino acid sequence is listed below: LDEDDEDTKP VPNRSTKGGQ QKNSQKGQHI EGRQTQSRPI QNVPGPHRTI HHASAPLTDN DRRNEPSGST SPRMLTPINE EADPLDDADD ETSSLPPLES DDEEQDRDGT SNRTPTVAPP APVYRDHSEK KELPQDEQQD QDHTQEARNQ DSDNTQSEHS FEEMYRHILR SQGPFDAVLY YHMMKDEPVV FSTSDGKEYT YPDSLEEEYP PWLTEKEAMN EENRFVTLDG QQFYWPVMNH KNKFMAILQH HQ . It is sometimes possible for the material contained within the vial of "Nucleoprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.