Nucleoprotein (N) E Coli Recombinant Protein
Recombinant Crimean-Congo hemorrhagic fever virus Nucleoprotein
Reactivity
Crimean-Congo hemorrhagic fever virus
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Nucleoprotein; N/A; Recombinant Crimean-Congo hemorrhagic fever virus Nucleoprotein; Nucleocapsid protein; N recombinant protein
Product Overview
Host
E Coli
Reactivity
Crimean-Congo hemorrhagic fever virus
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer 50% glycerol
Sequence Positions
Full Length, 1-482aa
Sequence
MENKIEVNNKDEMNKWFEEFKKGNGLVDTFTNPYSFCESVPNLERFVFQMASATDDAQKDSIYASALVEATK
FCAPIYECAWVSSTGIVKKGLEWFEKNAGTIKSWDESYIELKVEVPKIEQLANYQQAALKWRKDIGFRVNANTA
ALSHKVLAEYKVPGEIVMSVKEMLSDMIRRRNLILNRGGDENPRGPVSREHVEWCREFVKGKYIMAFNPPWG
DINKSGRSGIALVATGLAKLAETEGKGVFDEAKKTVEALNGYLDKHKDEVDKASADNMITNLLKHIAKAQELYK
NSSALRAQGAQIDTAFSSYYWLYKAGVTPETFPTVSQFLFELGKQPRGTKKMKKALLSTPMKWGKKLYELFA
DDSFQQNRIYMHPAVLTAGRISEMGVCFGTIPVANPDDAAQGSGHTKSILNLRTNTETNNPCAKTIVKLFEIQKT
GFNIQDMDIVASEHLLHQSLVGKQSPFQNAYNVKGNATSANII
Immunogen Description
Expression Region:1-482 aa; Sequence Info:Full Length
Calculated MW
68 kDa.
Tag Info
N-terminal 6xHis-B2M-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability
of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 monthsat -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 monthsat -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Related Product Information for N recombinant protein
RNA binding
NCBI and Uniprot Product Information
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The Nucleoprotein n (Catalog #AAA309804) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 1-482aa. The Recombinant Crimean-Congo hemorrhagic fever virus Nucleoprotein reacts with Crimean-Congo hemorrhagic fever virus and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: MENKIEVNNK DEMNKWFEEF KKGNGLVDTF TNPYSFCESV PNLERFVFQM ASATDDAQKD SIYASALVEA TK FCAPIYE CAWVSSTGIV KKGLEWFEKN AGTIKSWDES YIELKVEVPK IEQLANYQQA ALKWRKDIGF RVNANTA AL SHKVLAEYKV PGEIVMSVKE MLSDMIRRRN LILNRGGDEN PRGPVSREHV EWCREFVKGK YIMAFNPPWG DINKSGRSG IALVATGLAK LAETEGKGVF DEAKKTVEAL NGYLDKHKDE VDKASADNMI TNLLKHIAKA QELYK NSSA LRAQGAQIDT AFSSYYWLYK AGVTPETFPT VSQFLFELGK QPRGTKKMKK ALLSTPMKWG KKLYELFA D DSFQQNRIYM HPAVLTAGRI SEMGVCFGTI PVANPDDAAQ GSGHTKSILN LRTNTETNNP CAKTIVKLFE IQKT GFNIQ DMDIVASEHL LHQSLVGKQS PFQNAYNVKG NATSANII. It is sometimes possible for the material contained within the vial of "Nucleoprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.