Major Urinary Protein 11 (MUP8) E Coli Recombinant Protein
Recombinant mouse Major urinary proteins 11 and 8
Gene Names
Mup11; Gm12549
Reactivity
Mouse
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Major urinary proteins 11 and 8; N/A; Recombinant mouse Major urinary proteins 11 and 8; MUP11 and MUP8; MUP8 recombinant protein
Product Overview
Host
E Coli
Reactivity
Mouse
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer50% glycerol
Sequence Positions
32-181aa
Sequence
REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
Calculated MW
21.6 kDa
Tag Info
N-terminal 6xHis-tagged
Preparation and Storage
The shelf life is related to many factors , storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for MUP8 recombinant protein
Recombinant protein
Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21.6kD
NCBI Official Full Name
major urinary protein 11
NCBI Official Synonym Full Names
major urinary protein 11
NCBI Official Symbol
Mup11
NCBI Official Synonym Symbols
Gm12549
NCBI Protein Information
major urinary protein 11
UniProt Protein Name
Major urinary protein 11
UniProt Gene Name
Mup11
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The MUP8 mup11 (Catalog #AAA309755) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 32-181aa. The Recombinant mouse Major urinary proteins 11 and 8 reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: REKINGEWHT IILASDKREK IEDNGNFRLF LEQIHVLENS LVLKFHTVRD EECSELSMVA DKTEKAGEYS VTYDGFNTFT IPKTDYDNFL MAHLINEKDG ETFQLMGLYG REPDLSSDIK ERFAQLCEEH GILRENIIDL SNANRCLQAR E. It is sometimes possible for the material contained within the vial of "Major urinary proteins 11 and 8, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.