Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25877_IP6.jpg IP (Immunoprecipitation) (Immunoprecipitation of TYK2 transfected lysate using TYK2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TYK2 rabbit polyclonal antibody.)

Mouse anti-Human TYK2 Monoclonal Antibody | anti-TYK2 antibody

TYK2 (Non-receptor Tyrosine-protein Kinase TYK2, JTK1) (PE)

Gene Names
TYK2; JTK1; IMD35
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TYK2, Antibody; TYK2 (Non-receptor Tyrosine-protein Kinase TYK2, JTK1) (PE); EC=2.7.10.2; anti-TYK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6G12
Specificity
Recognizes human TYK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with R-Phycoerythrin (PE).
Concentration
0.45 mg/mL (varies by lot)
Applicable Applications for anti-TYK2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes

Applications are based on unconjugated antibody.
Immunohistochemistry: Formalin fixed, paraffin embedded tissues Optimal dilutions to be determined by the researcher.
IF: 10ug/ml
Immunogen
Partial recombinant corresponding to aa276-375 from human TYK2 (AAH14243) with GST tag. MW of the GST tag alone is 26kD.
Conjugate
PE
Amino Acid Sequence
PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAFGQPADRPREPLWA
Preparation and Storage
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IP (Immunoprecipitation)

(Immunoprecipitation of TYK2 transfected lysate using TYK2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TYK2 rabbit polyclonal antibody.)

product-image-AAA25877_IP6.jpg IP (Immunoprecipitation) (Immunoprecipitation of TYK2 transfected lysate using TYK2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with TYK2 rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to TYK2 on HeLa cells using [antibody concentration 10ug/ml])

product-image-AAA25877_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to TYK2 on HeLa cells using [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human colon using [antibody concentration 3ug/ml])

product-image-AAA25877_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TYK2 on formalin-fixed paraffin-embedded human colon using [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of TYK2 expression in transfected 293T cell line using 1: TYK2 transfected lysate (133.7kD).Lane 2: Non-transfected lysate.)

product-image-AAA25877_WB3.jpg WB (Western Blot) (Western Blot analysis of TYK2 expression in transfected 293T cell line using 1: TYK2 transfected lysate (133.7kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(TYK2 monoclonal antibody, Western Blot analysis of TYK2 expression in HeLa cells using .)

product-image-AAA25877_WB2.jpg WB (Western Blot) (TYK2 monoclonal antibody, Western Blot analysis of TYK2 expression in HeLa cells using .)

ELISA

(Detection limit for recombinant GST tagged TYK2 is 1ng/mL using AAA25877 as a capture antibody.)

product-image-AAA25877_ELISA.jpg ELISA (Detection limit for recombinant GST tagged TYK2 is 1ng/mL using AAA25877 as a capture antibody.)
Product Categories/Family for anti-TYK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens tyrosine kinase 2, mRNA
NCBI Official Synonym Full Names
tyrosine kinase 2
NCBI Official Symbol
TYK2
NCBI Official Synonym Symbols
JTK1; IMD35
NCBI Protein Information
non-receptor tyrosine-protein kinase TYK2

Similar Products

Product Notes

The TYK2 (Catalog #AAA25877) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TYK2 (Non-receptor Tyrosine-protein Kinase TYK2, JTK1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TYK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Immunohistochemistry: Formalin fixed, paraffin embedded tissues Optimal dilutions to be determined by the researcher. IF: 10ug/ml. Researchers should empirically determine the suitability of the TYK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TYK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.