Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26634_WB6.jpg WB (Western Blot) (RPS6KB1 monoclonal antibody (M03), clone 2C2. Western Blot analysis of RPS6KB1 expression in PC-12.)

Mouse RPS6KB1 Monoclonal Antibody | anti-RPS6KB1 antibody

RPS6KB1 (Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1, PS6K, S6K, S6K1, STK14A, p70(S6K)-alpha, p70-S6K, p70-alpha) (PE)

★ ★ ★ ★ ★
Average rating 0.0
No ratings yet
Gene Names
RPS6KB1; S6K; PS6K; S6K1; STK14A; p70-S6K; p70 S6KA; p70-alpha; S6K-beta-1; p70(S6K)-alpha
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
RPS6KB1, Antibody; RPS6KB1 (Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1, PS6K, S6K, S6K1, STK14A, p70(S6K)-alpha, p70-S6K, p70-alpha) (PE); Ribosomal Protein S6 Kinase; 70kD; Polypeptide 1; PS6K; S6K; S6K1; STK14A; p70(S6K)-alpha; p70-S6K; p70-alpha; anti-RPS6KB1 antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C2
Specificity
Recognizes RPS6KB1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RPS6KB1 antibody
IF (Immunofluorescence), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RPS6KB1 (NP_003152, 416aa-525aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(RPS6KB1 monoclonal antibody (M03), clone 2C2. Western Blot analysis of RPS6KB1 expression in PC-12.)

product-image-AAA26634_WB6.jpg WB (Western Blot) (RPS6KB1 monoclonal antibody (M03), clone 2C2. Western Blot analysis of RPS6KB1 expression in PC-12.)

WB (Western Blot)

(RPS6KB1 monoclonal antibody (M03), clone 2C2. Western Blot analysis of RPS6KB1 expression in NIH/3T3.)

product-image-AAA26634_WB5.jpg WB (Western Blot) (RPS6KB1 monoclonal antibody (M03), clone 2C2. Western Blot analysis of RPS6KB1 expression in NIH/3T3.)

Application Data

(Detection limit for recombinant GST tagged RPS6KB1 is approximately 0.1ng/ml as a capture antibody.)

product-image-AAA26634_APP4.jpg Application Data (Detection limit for recombinant GST tagged RPS6KB1 is approximately 0.1ng/ml as a capture antibody.)

WB (Western Blot)

(RPS6KB1 monoclonal antibody (M03), clone 2C2 Western Blot analysis of RPS6KB1 expression in A-431 (Cat # L015V1).)

product-image-AAA26634_WB3.jpg WB (Western Blot) (RPS6KB1 monoclonal antibody (M03), clone 2C2 Western Blot analysis of RPS6KB1 expression in A-431 (Cat # L015V1).)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RPS6KB1 on A-431 cell. [antibody concentration 10 ug/ml])

product-image-AAA26634_IF2.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RPS6KB1 on A-431 cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RPS6KB1 on A-431 cell. [antibody concentration 10 ug/ml])

product-image-AAA26634_IF.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RPS6KB1 on A-431 cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-RPS6KB1 antibody
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized. [provided by RefSeq]
Product Categories/Family for anti-RPS6KB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60.2kDa (533aa) 70-100kDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
ribosomal protein S6 kinase beta-1 isoform a
NCBI Official Synonym Full Names
ribosomal protein S6 kinase B1
NCBI Official Symbol
RPS6KB1
NCBI Official Synonym Symbols
S6K; PS6K; S6K1; STK14A; p70-S6K; p70 S6KA; p70-alpha; S6K-beta-1; p70(S6K)-alpha
NCBI Protein Information
ribosomal protein S6 kinase beta-1
UniProt Protein Name
Ribosomal protein S6 kinase beta-1
UniProt Gene Name
RPS6KB1
UniProt Synonym Gene Names
STK14A; S6K-beta-1; S6K1; P70S6K1; p70-S6K 1; p70 S6 kinase alpha; p70 S6K-alpha; p70 S6KA
UniProt Entry Name
KS6B1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The RPS6KB1 rps6kb1 (Catalog #AAA26634) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RPS6KB1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RPS6KB1 rps6kb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPS6KB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.