Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-RLIM Monoclonal Antibody – Cat# AAA25521 – WB (Western Blot) WB (Western Blot) (RNF12 monoclonal antibody, Western Blot analysis of RNF12 expression in HeLa NE.)

E3 Ubiquitin-Protein Ligase RLIM (RLIM) Antibody – Mouse Monoclonal

RLIM (RING Finger LIM Domain-binding Protein, R-LIM, E3 Ubiquitin-protein Ligase RLIM, LIM Domain-interacting RING Finger Protein, RING Finger Protein 12, RNF12, Renal Carcinoma Antigen NY-REN-43) (HRP)

Average rating 0.0
No ratings yet
Gene Names
RLIM; MRX61; RNF12; TOKAS; NY-REN-43
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RLIM, Antibody; RLIM (RING Finger LIM Domain-binding Protein, R-LIM, E3 Ubiquitin-protein Ligase RLIM, LIM Domain-interacting RING Finger Protein, RING Finger Protein 12, RNF12, Renal Carcinoma Antigen NY-REN-43) (HRP); EC=6.3.2.-; MGC15161; anti-RLIM antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G10
Specificity
Recognizes human RNF12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RLIM antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-84 from human RNF12 (NP_057204) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQFVNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQIKEGPPPQNSDEN
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(RNF12 monoclonal antibody, Western Blot analysis of RNF12 expression in HeLa NE.)

Mouse Anti-RLIM Monoclonal Antibody – Cat# AAA25521 – WB (Western Blot) WB (Western Blot) (RNF12 monoclonal antibody, Western Blot analysis of RNF12 expression in HeLa NE.)

Application Data

(Detection limit for recombinant GST tagged RNF12 is ~0.03ng/ml as a capture antibody.)

Mouse Anti-RLIM Monoclonal Antibody – Cat# AAA25521 – Application Data Application Data (Detection limit for recombinant GST tagged RNF12 is ~0.03ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of RNF12 transfected lysate using RNF12 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with RNF12 rabbit polyclonal antibody.)

Mouse Anti-RLIM Monoclonal Antibody – Cat# AAA25521 – IP (Immunoprecipitation) IP (Immunoprecipitation) (Immunoprecipitation of RNF12 transfected lysate using RNF12 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with RNF12 rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to RNF12 on HeLa cell. [antibody concentration 30ug/ml].)

Mouse Anti-RLIM Monoclonal Antibody – Cat# AAA25521 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to RNF12 on HeLa cell. [antibody concentration 30ug/ml].)

WB (Western Blot)

(Western Blot analysis of RNF12 expression in transfected 293T cell line by RNF12 monoclonal antibody. Lane 1: RNF12 transfected lysate (68.5kD). Lane 2: Non-transfected lysate.)

Mouse Anti-RLIM Monoclonal Antibody – Cat# AAA25521 – WB (Western Blot) WB (Western Blot) (Western Blot analysis of RNF12 expression in transfected 293T cell line by RNF12 monoclonal antibody. Lane 1: RNF12 transfected lysate (68.5kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (35.24kD).)

Mouse Anti-RLIM Monoclonal Antibody – Cat# AAA25521 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (35.24kD).)
Product Categories/Family for anti-RLIM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RLIM
NCBI Official Synonym Full Names
ring finger protein, LIM domain interacting
NCBI Official Symbol
RLIM
NCBI Official Synonym Symbols
MRX61; RNF12; TOKAS; NY-REN-43
NCBI Protein Information
E3 ubiquitin-protein ligase RLIM
UniProt Protein Name
E3 ubiquitin-protein ligase RLIM
UniProt Gene Name
RLIM
UniProt Synonym Gene Names
RNF12; R-LIM
UniProt Entry Name
RNF12_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RLIM rlim (Catalog #AAA25521) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RLIM (RING Finger LIM Domain-binding Protein, R-LIM, E3 Ubiquitin-protein Ligase RLIM, LIM Domain-interacting RING Finger Protein, RING Finger Protein 12, RNF12, Renal Carcinoma Antigen NY-REN-43) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RLIM can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RLIM rlim for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RLIM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.