Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-RAB33B Monoclonal Antibody – Cat# AAA25514 – WB (Western Blot) WB (Western Blot) (RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in NIH/3T3.)

Ras-Related Protein Rab-33B (RAB33B) Antibody – Mouse Monoclonal

RAB33B (Ras-related Protein Rab-33B, SMC2) (HRP)

Average rating 0.0
No ratings yet
Gene Names
RAB33B; SMC2
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAB33B, Antibody; RAB33B (Ras-related Protein Rab-33B, SMC2) (HRP); DKFZp434G099; MGC138182; anti-RAB33B antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6F4
Specificity
Recognizes human RAB33B. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RAB33B antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa117-207 from human RAB33B (NP_112586) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLM
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in NIH/3T3.)

Mouse Anti-RAB33B Monoclonal Antibody – Cat# AAA25514 – WB (Western Blot) WB (Western Blot) (RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in NIH/3T3.)

Application Data

(Detection limit for recombinant GST tagged RAB33B is ~0.03ng/ml as a capture antibody.)

Mouse Anti-RAB33B Monoclonal Antibody – Cat# AAA25514 – Application Data Application Data (Detection limit for recombinant GST tagged RAB33B is ~0.03ng/ml as a capture antibody.)

WB (Western Blot)

(RAB33B monoclonal antibody, Western Blot analysis of RAB33B expression in A-431.)

Mouse Anti-RAB33B Monoclonal Antibody – Cat# AAA25514 – WB (Western Blot) WB (Western Blot) (RAB33B monoclonal antibody, Western Blot analysis of RAB33B expression in A-431.)

WB (Western Blot)

(RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in PC-12.)

Mouse Anti-RAB33B Monoclonal Antibody – Cat# AAA25514 – WB (Western Blot) WB (Western Blot) (RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in PC-12.)

WB (Western Blot)

(RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in HeLa.)

Mouse Anti-RAB33B Monoclonal Antibody – Cat# AAA25514 – WB (Western Blot) WB (Western Blot) (RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.01kD).)

Mouse Anti-RAB33B Monoclonal Antibody – Cat# AAA25514 – WB (Western Blot) WB (Western Blot) (Western Blot detection against Immunogen (36.01kD).)
Product Categories/Family for anti-RAB33B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,718 Da
NCBI Official Full Name
ras-related protein Rab-33B
NCBI Official Synonym Full Names
RAB33B, member RAS oncogene family
NCBI Official Symbol
RAB33B
NCBI Official Synonym Symbols
SMC2
NCBI Protein Information
ras-related protein Rab-33B
UniProt Protein Name
Ras-related protein Rab-33B
UniProt Gene Name
RAB33B
UniProt Entry Name
RB33B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RAB33B rab33b (Catalog #AAA25514) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB33B (Ras-related Protein Rab-33B, SMC2) (HRP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAB33B can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB33B rab33b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB33B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.