Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24058_WB6.jpg WB (Western Blot) (Western blot analysis of PIP5K3 over-expressed 293 cell line, cotransfected with PIP5K3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PIP5K3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human PIP5K3 Monoclonal Antibody | anti-PIKFYVE antibody

PIP5K3 (PIKFYVE, 1-phosphatidylinositol 3-phosphate 5-kinase, Phosphatidylinositol 3-phosphate 5-kinase, FYVE Finger-containing Phosphoinositide Kinase, PIKfyve, Phosphatidylinositol 3-phosphate 5-kinase Type III, PIPkin-III, Type III PIP Kinase, KIAA0981

Gene Names
PIKFYVE; CFD; FAB1; PIP5K; PIP5K3; ZFYVE29
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PIP5K3, Antibody; PIP5K3 (PIKFYVE, 1-phosphatidylinositol 3-phosphate 5-kinase, Phosphatidylinositol 3-phosphate 5-kinase, FYVE Finger-containing Phosphoinositide Kinase, PIKfyve, Phosphatidylinositol 3-phosphate 5-kinase Type III, PIPkin-III, Type III PIP Kinase, KIAA0981; Anti -PIP5K3 (PIKFYVE, 1-phosphatidylinositol 3-phosphate 5-kinase, Phosphatidylinositol 3-phosphate 5-kinase, FYVE Finger-containing Phosphoinositide Kinase, PIKfyve, Phosphatidylinositol 3-phosphate 5-kinase Type III, PIPkin-III, Type III PIP Kinase, KIAA0981; anti-PIKFYVE antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6C7
Specificity
Recognizes human PIP5K3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR
Applicable Applications for anti-PIKFYVE antibody
ELISA, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant protein corresponding to aa342-452 from human PIP5K3 (NP_689884) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of PIP5K3 over-expressed 293 cell line, cotransfected with PIP5K3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PIP5K3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24058_WB6.jpg WB (Western Blot) (Western blot analysis of PIP5K3 over-expressed 293 cell line, cotransfected with PIP5K3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PIP5K3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged PIP5K3 is ~0.3ng/ml as a capture antibody.)

product-image-AAA24058_APP5.jpg Application Data (Detection limit for recombinant GST tagged PIP5K3 is ~0.3ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PIP5K3 on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA24058_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PIP5K3 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to PIP5K3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

product-image-AAA24058_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to PIP5K3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of PIP5K3 expression in transfected 293T cell line by PIP5K3 monoclonal antibody.Lane 1: PIP5K3 transfected lysate (50.2kD).Lane 2: Non-transfected lysate.)

product-image-AAA24058_WB2.jpg WB (Western Blot) (Western Blot analysis of PIP5K3 expression in transfected 293T cell line by PIP5K3 monoclonal antibody.Lane 1: PIP5K3 transfected lysate (50.2kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.21kD).)

product-image-AAA24058_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (38.21kD).)
Related Product Information for anti-PIKFYVE antibody
The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Catalyzes the phosphorylation of phosphatidylinositol 3-phosphate on the fifth hydroxyl of the myo-inositol ring, to form phosphatidylinositol 3,5-bisphosphate. Required for endocytic-vacuolar pathway and nuclear migration. Plays a role in the biogenesis of endosome carrier vesicles (ECV)/ multivesicular bodies (MVB) transport intermediates from early endosomes.
Product Categories/Family for anti-PIKFYVE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
237,136 Da
NCBI Official Full Name
PIP5K3 protein
NCBI Official Synonym Full Names
phosphoinositide kinase, FYVE finger containing
NCBI Official Symbol
PIKFYVE
NCBI Official Synonym Symbols
CFD; FAB1; PIP5K; PIP5K3; ZFYVE29
NCBI Protein Information
1-phosphatidylinositol 3-phosphate 5-kinase; PIPkin-III; type III PIP kinase; zinc finger, FYVE domain containing 29; 1-phosphatidylinositol-3-phosphate 5-kinase; phosphatidylinositol 3-phosphate 5-kinase type III; phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III
UniProt Protein Name
1-phosphatidylinositol 3-phosphate 5-kinase
UniProt Gene Name
PIKFYVE
UniProt Synonym Gene Names
KIAA0981; PIP5K3; Phosphatidylinositol 3-phosphate 5-kinase; PIPkin-III
UniProt Entry Name
FYV1_HUMAN

Similar Products

Product Notes

The PIKFYVE pikfyve (Catalog #AAA24058) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PIP5K3 (PIKFYVE, 1-phosphatidylinositol 3-phosphate 5-kinase, Phosphatidylinositol 3-phosphate 5-kinase, FYVE Finger-containing Phosphoinositide Kinase, PIKfyve, Phosphatidylinositol 3-phosphate 5-kinase Type III, PIPkin-III, Type III PIP Kinase, KIAA0981 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIP5K3 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence). Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the PIKFYVE pikfyve for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LQSTEFSETP SPDSDSVNSV EGHSEPSWFK DIKFDDSDTE QIAEEGDDNL ANSASPSKRT SVSSFQSTVD SDSAASISLN VELDNVNFHI KKPSKYPHVP PHPADQKGRR. It is sometimes possible for the material contained within the vial of "PIP5K3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.