Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25793_APP7.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between PDGFRB and PLCG1. Mahlavu cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and anti-PLCG1 mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Mouse anti-Human Phospholipase C, gamma 1 Monoclonal Antibody | anti-PLCg1 antibody

Phospholipase C, gamma 1 (Phospholipase C-gamma-1, PLCgamma1, PLC-gamma-1, PLCg1, NCKAP3, 1-Phosphatidylinositol-4,5-bisphosphate Phosphodiesterase gamma-1, Phospholipase C-II, PLC-II, Phosphoinositide Phospholipase C-gamma-1, PLC1, PLC148, PLC-148) (PE)

Gene Names
PLCG1; PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Phospholipase C, gamma 1, Antibody; Phospholipase C, gamma 1 (Phospholipase C-gamma-1, PLCgamma1, PLC-gamma-1, PLCg1, NCKAP3, 1-Phosphatidylinositol-4,5-bisphosphate Phosphodiesterase gamma-1, Phospholipase C-II, PLC-II, Phosphoinositide Phospholipase C-gamma-1, PLC1, PLC148, PLC-148) (PE); anti-PLCg1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A2
Specificity
Recognizes human PLCG1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1291
Applicable Applications for anti-PLCg1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 40ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1192-1292 from human PLCG1 (NP_002651) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Proximity Ligation Analysis of protein-protein interactions between PDGFRB and PLCG1. Mahlavu cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and anti-PLCG1 mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

product-image-AAA25793_APP7.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between PDGFRB and PLCG1. Mahlavu cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and anti-PLCG1 mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Application Data

(Proximity Ligation Analysis of protein-protein interactions between HCK and PLCG1. Huh7 cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

product-image-AAA25793_APP6.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between HCK and PLCG1. Huh7 cells were stained with anti-HCK rabbit purified polyclonal 1:1200 and anti-PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Application Data

(Proximity Ligation Analysis of protein-protein interactions between PTK2 and PLCG1 HeLa cells were stained with PTK2 rabbit purified polyclonal 1:1200 and PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

product-image-AAA25793_APP5.jpg Application Data (Proximity Ligation Analysis of protein-protein interactions between PTK2 and PLCG1 HeLa cells were stained with PTK2 rabbit purified polyclonal 1:1200 and PLCG1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Application Data

(Detection limit for recombinant GST tagged PLCG1 is ~0.1ng/ml as a capture antibody.)

product-image-AAA25793_APP4.jpg Application Data (Detection limit for recombinant GST tagged PLCG1 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to PLCG1 on HeLa cell. [antibody concentration 40ug/ml].)

product-image-AAA25793_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to PLCG1 on HeLa cell. [antibody concentration 40ug/ml].)

WB (Western Blot)

(PLCG1 monoclonal antibody. Western Blot analysis of PLCG1 expression in Hela NE.)

product-image-AAA25793_WB2.jpg WB (Western Blot) (PLCG1 monoclonal antibody. Western Blot analysis of PLCG1 expression in Hela NE.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

product-image-AAA25793_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.74kD).)
Product Categories/Family for anti-PLCg1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform a
NCBI Official Synonym Full Names
phospholipase C gamma 1
NCBI Official Symbol
PLCG1
NCBI Official Synonym Symbols
PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1
NCBI Protein Information
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
UniProt Protein Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
UniProt Gene Name
PLCG1
UniProt Synonym Gene Names
PLC1; PLC-II; PLC-gamma-1
UniProt Entry Name
PLCG1_HUMAN

Similar Products

Product Notes

The PLCg1 plcg1 (Catalog #AAA25793) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Phospholipase C, gamma 1 (Phospholipase C-gamma-1, PLCgamma1, PLC-gamma-1, PLCg1, NCKAP3, 1-Phosphatidylinositol-4,5-bisphosphate Phosphodiesterase gamma-1, Phospholipase C-II, PLC-II, Phosphoinositide Phospholipase C-gamma-1, PLC1, PLC148, PLC-148) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Phospholipase C, gamma 1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 40ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLCg1 plcg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Phospholipase C, gamma 1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.