Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26433_APP6.jpg Application Data (Detection limit for recombinant GST tagged NME1 is approximately 0.1ng/ml as a capture antibody.)

Mouse NME1 Monoclonal Antibody | anti-NME1 antibody

NME1 (Non-Metastatic Cells 1, Protein (NM23A) Expressed in, AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1) (HRP)

Gene Names
NME1; NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
Applications
Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
NME1, Antibody; NME1 (Non-Metastatic Cells 1, Protein (NM23A) Expressed in, AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1) (HRP); Non-Metastatic Cells 1; Protein (NM23A) Expressed in; AWD; GAAD; NB; NBS; NDPK-A; NDPKA; NM23; NM23-H1; anti-NME1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D7
Specificity
Recognizes NME1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-NME1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NME1 (NP_000260, 43aa-152aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged NME1 is approximately 0.1ng/ml as a capture antibody.)

product-image-AAA26433_APP6.jpg Application Data (Detection limit for recombinant GST tagged NME1 is approximately 0.1ng/ml as a capture antibody.)

WB (Western Blot)

(NME1 monoclonal antibody (M02), clone 1D7. Western Blot analysis of NME1 expression in different cell lines.)

product-image-AAA26433_WB5.jpg WB (Western Blot) (NME1 monoclonal antibody (M02), clone 1D7. Western Blot analysis of NME1 expression in different cell lines.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26433_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26433_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to NME1 on HeLa cell. [antibody concentration 10 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

product-image-AAA26433_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])

product-image-AAA26433_APP.jpg Application Data (Immunoperoxidase of monoclonal antibody to NME1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml])
Product Categories/Family for anti-NME1 antibody
References
1. Identification of Antigenic Proteins Associated with Trichloroethylene-Induced Autoimmune Disease by Serological Proteome Analysis.Liu J, Xing X, Huang H, Jiang Y, He H, Xu X, Yuan J, Zhou L, Yang L, Zhuang Z.Toxicol Appl Pharmacol. 2009 Nov 1;240(3):393-400. Epub 2009 Aug 6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,137 Da
NCBI Official Full Name
nucleoside diphosphate kinase A isoform b
NCBI Official Synonym Full Names
NME/NM23 nucleoside diphosphate kinase 1
NCBI Official Symbol
NME1
NCBI Official Synonym Symbols
NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
NCBI Protein Information
nucleoside diphosphate kinase A
UniProt Protein Name
Nucleoside diphosphate kinase A
UniProt Gene Name
NME1
UniProt Synonym Gene Names
NDPKA; NM23; NDK A; NDP kinase A; GAAD
UniProt Entry Name
NDKA_HUMAN

Similar Products

Product Notes

The NME1 nme1 (Catalog #AAA26433) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NME1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NME1 nme1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NME1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.