Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28456_WB7.jpg WB (Western Blot) (Western blot analysis of various lysates using GM130 Rabbit mAb (AAA28456) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

Rabbit anti-Human GM130 Monoclonal Antibody | anti-GOLGA2 antibody

GM130 Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity purification
Synonyms
GM130, Antibody; GM130 Rabbit mAb; GM130; DEDHMB; anti-GOLGA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSM
Applicable Applications for anti-GOLGA2 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA)
Application Notes
WB: 1:1000-1:6000
IHC-P: 1:200-1:2000
IF/ICC: 1:100-1:2000
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GM130 (Q08379).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of various lysates using GM130 Rabbit mAb (AAA28456) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

product-image-AAA28456_WB7.jpg WB (Western Blot) (Western blot analysis of various lysates using GM130 Rabbit mAb (AAA28456) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

WB (Western Blot)

(Western blot analysis of various lysates using GM130 Rabbit mAb (AAA28456) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA28456_WB6.jpg WB (Western Blot) (Western blot analysis of various lysates using GM130 Rabbit mAb (AAA28456) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using GM130 Rabbit mAb (AAA28456) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

product-image-AAA28456_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using GM130 Rabbit mAb (AAA28456) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using GM130 Rabbit mAb (AAA28456) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

product-image-AAA28456_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using GM130 Rabbit mAb (AAA28456) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.)

ICC (Immunocytochemistry)

(Confocal imaging of HeLa cells using GM130 Rabbit mAb (AAA28456, dilution 1:100) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:200) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.)

product-image-AAA28456_ICC3.jpg ICC (Immunocytochemistry) (Confocal imaging of HeLa cells using GM130 Rabbit mAb (AAA28456, dilution 1:100) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:200) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.)

Application Data

(The STORM super-resolution (SR) imaging of U-2 OS cells using GM130 Rabbit mAb (AAA28456, ABclonal) at dilution of 1:200 with 3% paraformaldehyde (PFA) +0.1% glutaraldehyde (GA) fixation. The immunostaining was performed by Full Automatic Immunofluorescence Workflow System (Workflow Ultra300, Nano-Micro imaging, China). Image was performed with Single-Molecule Localization Super-Resolution Microscopy (STORM Ultra300, Nano-Micro imaging, China). We acknowledge Nano-Micro imaging Biotechnology Co., Ltd. in SR image processing and kindly providing this image.)

product-image-AAA28456_APP2.jpg Application Data (The STORM super-resolution (SR) imaging of U-2 OS cells using GM130 Rabbit mAb (AAA28456, ABclonal) at dilution of 1:200 with 3% paraformaldehyde (PFA) +0.1% glutaraldehyde (GA) fixation. The immunostaining was performed by Full Automatic Immunofluorescence Workflow System (Workflow Ultra300, Nano-Micro imaging, China). Image was performed with Single-Molecule Localization Super-Resolution Microscopy (STORM Ultra300, Nano-Micro imaging, China). We acknowledge Nano-Micro imaging Biotechnology Co., Ltd. in SR image processing and kindly providing this image.)

Application Data

(The STORM super-resolution (SR) imaging of U-2 OS cells using GM130 Rabbit mAb (AAA28456, ABclonal) at dilution of 1:200 with 3% paraformaldehyde (PFA) +0.1% glutaraldehyde (GA) fixation. The immunostaining was performed by Full Automatic Immunofluorescence Workflow System (Workflow Ultra300, Nano-Micro imaging, China). Image was performed with Single-Molecule Localization Super-Resolution Microscopy (STORM Ultra300, Nano-Micro imaging, China). We acknowledge Nano-Micro imaging Biotechnology Co., Ltd. (??????????????) in SR image processing and kindly providing this image.)

product-image-AAA28456_APP.jpg Application Data (The STORM super-resolution (SR) imaging of U-2 OS cells using GM130 Rabbit mAb (AAA28456, ABclonal) at dilution of 1:200 with 3% paraformaldehyde (PFA) +0.1% glutaraldehyde (GA) fixation. The immunostaining was performed by Full Automatic Immunofluorescence Workflow System (Workflow Ultra300, Nano-Micro imaging, China). Image was performed with Single-Molecule Localization Super-Resolution Microscopy (STORM Ultra300, Nano-Micro imaging, China). We acknowledge Nano-Micro imaging Biotechnology Co., Ltd. (??????????????) in SR image processing and kindly providing this image.)
Related Product Information for anti-GOLGA2 antibody
The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined.
Product Categories/Family for anti-GOLGA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 113kDa
Observed MW: 130kDa
UniProt Protein Name
Golgin subfamily A member 2
UniProt Gene Name
GOLGA2
UniProt Synonym Gene Names
GM1301 PublicationManual assertion based on opinion iniRef.1

Similar Products

Product Notes

The GOLGA2 golga2 (Catalog #AAA28456) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GM130 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GM130 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA). WB: 1:1000-1:6000 IHC-P: 1:200-1:2000 IF/ICC: 1:100-1:2000 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the GOLGA2 golga2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MWPQPRLPPR PAMSEETRQS KLAAAKKKLR EYQQRNSPGV PTGAKKKKKI KNGSNPETTT SGGCHSPEDT PKDNAATLQP SDDTVLPGGV PSPGASLTSM. It is sometimes possible for the material contained within the vial of "GM130, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.