Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA14793_WB6.jpg WB (Western Blot) (Western Blot detection against Immunogen (51.96kD).)

Mouse anti-Human FAM3B Monoclonal Antibody

FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11, D21M16SJHU19e)

Reactivity
Human
Applications
ELISA, Western Blot, Immunoprecipitation, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FAM3B, Antibody; FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11, D21M16SJHU19e); Anti -FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11, D21M16SJHU19e); anti-FAM3B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E7
Specificity
Recognizes human FAM3B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Applicable Applications for anti-FAM3B antibody
ELISA, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry)
Application Notes
Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Full length recombinant corresponding to aa1-236 from human FAM3B (AAH57829) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (51.96kD).)

product-image-AAA14793_WB6.jpg WB (Western Blot) (Western Blot detection against Immunogen (51.96kD).)

Application Data

(Detection limit for recombinant GST tagged FAM3B is 1ng/ml as a capture antibody.)

product-image-AAA14793_APP5.jpg Application Data (Detection limit for recombinant GST tagged FAM3B is 1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of FAM3B transfected lysate using FAM3B monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FAM3B rabbit polyclonal antibody.)

product-image-AAA14793_IP4.jpg IP (Immunoprecipitation) (Immunoprecipitation of FAM3B transfected lysate using FAM3B monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FAM3B rabbit polyclonal antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to FAM3B on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

product-image-AAA14793_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to FAM3B on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of FAM3B expression in transfected 293T cell line by FAM3B monoclonal antibody.Lane 1: FAM3B transfected lysate (26kD).Lane 2: Non-transfected lysate.)

product-image-AAA14793_WB2.jpg WB (Western Blot) (Western Blot analysis of FAM3B expression in transfected 293T cell line by FAM3B monoclonal antibody.Lane 1: FAM3B transfected lysate (26kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(FAM3B monoclonal antibody. Western Blot analysis of FAM3B expression in human kidney.)

product-image-AAA14793_WB.jpg WB (Western Blot) (FAM3B monoclonal antibody. Western Blot analysis of FAM3B expression in human kidney.)
Related Product Information for anti-FAM3B antibody
Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.
Product Categories/Family for anti-FAM3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
FAM3B

Similar Products

Product Notes

The FAM3B (Catalog #AAA14793) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11, D21M16SJHU19e) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAM3B can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry). Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the FAM3B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRPLAGGLLK VVFVVFASLC AWYSGYLLAE LIPDAPLSSA AYSIRSIGER PVLKAPVPKR QKCDHWTPCP SDTYAYRLLS GGGRSKYAKI CFEDNLLMGE QLGNVARGIN IAIVNYVTGN VTATRCFDMY EGDNSGPMTK FIQSAAPKSL LFMVTYDDGS TRLNNDAKNA IEALGSKEIR NMKFRSSWVF IAAKGLELPS EIQREKINHS DAKNNRYSGW PAEIQIEGCI PKERS. It is sometimes possible for the material contained within the vial of "FAM3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.