Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24755_WB6.jpg WB (Western Blot) (CDK2 monoclonal antibody. Western Blot analysis of CDK2 expression in Jurkat.)

Mouse anti-Human CDK2 Monoclonal Antibody | anti-CDK2 antibody

CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (Biotin)

Gene Names
CDK2; CDKN2; p33(CDK2)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDK2, Antibody; CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (Biotin); anti-CDK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E8
Specificity
Recognizes human CDK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CDK2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa211-298 from human CDK2 (AAH03065) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(CDK2 monoclonal antibody. Western Blot analysis of CDK2 expression in Jurkat.)

product-image-AAA24755_WB6.jpg WB (Western Blot) (CDK2 monoclonal antibody. Western Blot analysis of CDK2 expression in Jurkat.)

WB (Western Blot)

(Western blot analysis of CDK2 over-expressed 293 cell line, cotransfected with CDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24755_WB5.jpg WB (Western Blot) (Western blot analysis of CDK2 over-expressed 293 cell line, cotransfected with CDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged CDK2 is ~0.03ng/ml as a capture antibody.)

product-image-AAA24755_APP4.jpg Application Data (Detection limit for recombinant GST tagged CDK2 is ~0.03ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of CDK2 expression in transfected 293T cell line by CDK2 monoclonal antibody. Lane 1: CDK2 transfected lysate (33.9kD). Lane 2: Non-transfected lysate.)

product-image-AAA24755_WB3.jpg WB (Western Blot) (Western Blot analysis of CDK2 expression in transfected 293T cell line by CDK2 monoclonal antibody. Lane 1: CDK2 transfected lysate (33.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(CDK2 monoclonal antibody, Western Blot analysis of CDK2 expression in HL-60.)

product-image-AAA24755_WB2.jpg WB (Western Blot) (CDK2 monoclonal antibody, Western Blot analysis of CDK2 expression in HL-60.)

WB (Western Blot)

(Western Blot detection against Immunogen (35.42kD).)

product-image-AAA24755_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (35.42kD).)
Related Product Information for anti-CDK2 antibody
CDK2 a serine/threonine protein kinase, is a member of a highly conserved family of protein kinases that regulate the eukaryotic cell cycle. The protein kinase is homologous to the gene products of S. cerevisiae cdc28, and S. pombe cdc2. For activity, it requires association with a cyclins which act as the positive regulatory subunit. It forms complex with cyclins A, E, D1, and D3. Cyclin E- CDK2 kinase is active in the G1 and S phases of the cell cycle and is important for the progression from G1 to S phase. The levels of Cyclin A- CDK2 are maximal at the G1/S transition and both CDK2 and Cyclin A associate with DNA in the initiation complex during replication.
Product Categories/Family for anti-CDK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
30,035 Da
NCBI Official Full Name
Homo sapiens cyclin-dependent kinase 2, mRNA
NCBI Official Synonym Full Names
cyclin dependent kinase 2
NCBI Official Symbol
CDK2
NCBI Official Synonym Symbols
CDKN2; p33(CDK2)
NCBI Protein Information
cyclin-dependent kinase 2

Similar Products

Product Notes

The CDK2 (Catalog #AAA24755) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.