Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SNCA Monoclonal Antibody – Cat# AAA28554 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of Neuro-2a cells using ?-Synuclein Rabbit PolymAb® (AAA28554, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

Alpha-Synuclein (SNCA) Antibody – Rabbit Monoclonal

alpha-Synuclein Rabbit PolymAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity purification
Synonyms
alpha-Synuclein, Antibody; alpha-Synuclein Rabbit PolymAb; PD1; NACP; PARK1; PARK4; anti-SNCA antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
TKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Applicable Applications for anti-SNCA antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA
Application Notes
WB: 1:500-1:1000
IHC-P: 1:1000-1:5000
IF/ICC: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 59-140 of human alpha-Synuclein Rabbit PolymAb (NP_000336.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of Neuro-2a cells using ?-Synuclein Rabbit PolymAb® (AAA28554, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

Rabbit Anti-SNCA Monoclonal Antibody – Cat# AAA28554 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of Neuro-2a cells using ?-Synuclein Rabbit PolymAb® (AAA28554, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of SH-SY5Y cells using ?-Synuclein Rabbit PolymAb® (AAA28554, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

Rabbit Anti-SNCA Monoclonal Antibody – Cat# AAA28554 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of SH-SY5Y cells using ?-Synuclein Rabbit PolymAb® (AAA28554, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

IF (Immunofluorescence)

(Immunofluorescence analysis of Neuro-2a cells using ?-Synuclein Rabbit PolymAb? (AAA28554) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit Anti-SNCA Monoclonal Antibody – Cat# AAA28554 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence analysis of Neuro-2a cells using ?-Synuclein Rabbit PolymAb? (AAA28554) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using ?-Synuclein Rabbit PolymAb® (AAA28554) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit Anti-SNCA Monoclonal Antibody – Cat# AAA28554 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using ?-Synuclein Rabbit PolymAb® (AAA28554) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human brain tissue using ?-Synuclein Rabbit PolymAb® (AAA28554) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit Anti-SNCA Monoclonal Antibody – Cat# AAA28554 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human brain tissue using ?-Synuclein Rabbit PolymAb® (AAA28554) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using ?-Synuclein Rabbit PolymAb® (AAA28554) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Rabbit Anti-SNCA Monoclonal Antibody – Cat# AAA28554 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using ?-Synuclein Rabbit PolymAb® (AAA28554) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates, using ?-Synuclein Rabbit PolymAb® (AAA28554) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit Anti-SNCA Monoclonal Antibody – Cat# AAA28554 – WB (Western Blot) WB (Western Blot) (Western blot analysis of various lysates, using ?-Synuclein Rabbit PolymAb® (AAA28554) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of various lysates, using ?-Synuclein Rabbit PolymAb® (AAA28554) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Rabbit Anti-SNCA Monoclonal Antibody – Cat# AAA28554 – WB (Western Blot) WB (Western Blot) (Western blot analysis of various lysates, using ?-Synuclein Rabbit PolymAb® (AAA28554) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-SNCA antibody
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 14kDa
Observed MW: 18kDa
UniProt Protein Name
Alpha-synuclein
UniProt Gene Name
SNCA
UniProt Synonym Gene Names
NACP; PARK1; NACP
UniProt Entry Name
SYUA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SNCA snca (Catalog #AAA28554) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The alpha-Synuclein Rabbit PolymAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's alpha-Synuclein can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA. WB: 1:500-1:1000 IHC-P: 1:1000-1:5000 IF/ICC: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the SNCA snca for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TKEQVTNVGG AVVTGVTAVA QKTVEGAGSI AAATGFVKKD QLGKNEEGAP QEGILEDMPV DPDNEAYEMP SEEGYQDYEP EA. It is sometimes possible for the material contained within the vial of "alpha-Synuclein, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.