Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ALDH1A1 Monoclonal Antibody – Cat# AAA28553 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence analysis of HepG2 cells using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:800 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Retinal Dehydrogenase 1 (ALDH1A1) Antibody – Rabbit Monoclonal

ALDH1A1 Rabbit PolymAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
Purity
Affinity purification
Synonyms
ALDH1A1, Antibody; ALDH1A1 Rabbit PolymAb; ALDC; ALDH1; HEL-9; HEL12; PUMB1; ALDH11; RALDH1; ALDH-E1; HEL-S-53e; anti-ALDH1A1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
VGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
Applicable Applications for anti-ALDH1A1 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA
Application Notes
WB: 1:10000-1:60000
IHC-P: 1:100-1:500
IF/ICC: 1:500-1:1000
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human ALDH1A1 Rabbit PolymAb (NP_000680.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of HepG2 cells using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:800 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit Anti-ALDH1A1 Monoclonal Antibody – Cat# AAA28553 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence analysis of HepG2 cells using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:800 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A-549 cells using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:800 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit Anti-ALDH1A1 Monoclonal Antibody – Cat# AAA28553 – IF (Immunofluorescence) IF (Immunofluorescence) (Immunofluorescence analysis of A-549 cells using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:800 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat kidney using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

Rabbit Anti-ALDH1A1 Monoclonal Antibody – Cat# AAA28553 – IHC (Immunohistchemistry) IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat kidney using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse testis using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

Rabbit Anti-ALDH1A1 Monoclonal Antibody – Cat# AAA28553 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse testis using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

Rabbit Anti-ALDH1A1 Monoclonal Antibody – Cat# AAA28553 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human tonsil using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

Rabbit Anti-ALDH1A1 Monoclonal Antibody – Cat# AAA28553 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver cancer using ALDH1A1 Rabbit PolymAb® (AAA28553) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from rat lung, using ALDH1A1 Rabbit PolymAb® (AAA28553) at 1:50000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit Anti-ALDH1A1 Monoclonal Antibody – Cat# AAA28553 – WB (Western Blot) WB (Western Blot) (Western blot analysis of lysates from rat lung, using ALDH1A1 Rabbit PolymAb® (AAA28553) at 1:50000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of various lysates, using ALDH1A1 Rabbit PolymAb® (AAA28553) at 1:50000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Negative control (NC): THP-1Exposure time: 20s.)

Rabbit Anti-ALDH1A1 Monoclonal Antibody – Cat# AAA28553 – WB (Western Blot) WB (Western Blot) (Western blot analysis of various lysates, using ALDH1A1 Rabbit PolymAb® (AAA28553) at 1:50000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Negative control (NC): THP-1Exposure time: 20s.)
Related Product Information for anti-ALDH1A1 antibody
The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
216
UniProt Accession #
Molecular Weight
Calculated MW: 55kDa
Observed MW: 55kDa
UniProt Protein Name
Retinal dehydrogenase 1
UniProt Gene Name
ALDH1A1
UniProt Synonym Gene Names
ALDC; ALDH1; PUMB1; RALDH 1; RalDH1
UniProt Entry Name
AL1A1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ALDH1A1 aldh1a1 (Catalog #AAA28553) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALDH1A1 Rabbit PolymAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH1A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), ELISA. WB: 1:10000-1:60000 IHC-P: 1:100-1:500 IF/ICC: 1:500-1:1000 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the ALDH1A1 aldh1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VGKLIKEAAG KSNLKRVTLE LGGKSPCIVL ADADLDNAVE FAHHGVFYHQ GQCCIAASRI FVEESIYDEF VRRSVERAKK YILGNPLTPG VTQGPQIDKE Q. It is sometimes possible for the material contained within the vial of "ALDH1A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.