Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E. Coli AA 101-469 (P03956). MMP1 Recombinant Protein – Cat# AAA55955 – SDS-PAGE SDS-PAGE

Interstitial Collagenase Isoform 1 Preproprotein (MMP1) E. Coli AA 101-469 (P03956). Recombinant Protein

Recombinant Human MMP1 Protein, Recombinant Human Matrix Metalloproteinase 1(MMP1) Protein

Average rating 0.0
No ratings yet
Gene Names
MMP1; CLG; CLGN
Applications
ELISA, Western Blot
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
MMP1; N/A; Recombinant Human MMP1 Protein, Recombinant Human Matrix Metalloproteinase 1(MMP1) Protein; CLGN; CLG1; Collagenase; Interstitial Collagenase; Vertebrate Collagenase; Fibroblast Collagenase; MMP1 recombinant protein
Ordering

Product Overview

Host
E. coli AA 101-469 (P03956).
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
In 10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol.
Concentration
0.8 mg/mL (varies by lot)
Sequence Positions
101-469
Sequence
VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Sequence Length
469
Applicable Applications for MMP1 recombinant protein
ELISA, WB (Western Blot)
Source
Human
Predicted Molecular Mass
Predicted MW: 46.5 kDa
Observed MW: 46.5 kDa
Protein Residues
with N-terminal 6×His-tag.
Usage
MMP1 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.

**Avoid repeated freeze-thaw cycles.**

Stability: The recombinant protein is stable for up to 6 months from date of receipt at -80°C.

SDS-PAGE

E. Coli AA 101-469 (P03956). MMP1 Recombinant Protein – Cat# AAA55955 – SDS-PAGE SDS-PAGE
Related Product Information for MMP1 recombinant protein
MMP-1 is produced by fibroblasts, chondrocytes, macrophages, endothelial cells, and osteoblasts. It is induced by the pro-inflammatory cytokines IL-1 and TNF-alpha, various growth factors such as EGF, PDGF, FGF basic, and Oncostatin M, chemical agents such as cAMP and phorbol esters and events occurring at the cell surface such as cell fusion and phagocytosis. MMP-1 plays a significant role in the degradation of different types of collagen in extracellular matrix remodeling. It is implicated in a variety of processes involving collagen degradation such as emphysema, atherosclerosis, rheumatoid and osteoarthritis, periodontal and respiratory disease, angiogenesis and tumorigenesis, tissue remodeling and wound healing, and inflammatory bowel disease.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interstitial collagenase isoform 1 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 1
NCBI Official Symbol
MMP1
NCBI Official Synonym Symbols
CLG; CLGN
NCBI Protein Information
interstitial collagenase
UniProt Protein Name
Interstitial collagenase
UniProt Gene Name
MMP1
UniProt Synonym Gene Names
CLG; MMP-1
UniProt Entry Name
MMP1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The MMP1 mmp1 (Catalog #AAA55955) is a Recombinant Protein produced from E. coli AA 101-469 (P03956). and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 101-469. AAA Biotech's MMP1 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the MMP1 mmp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VLTEGNPRWE QTHLTYRIEN YTPDLPRADV DHAIEKAFQL WSNVTPLTFT KVSEGQADIM ISFVRGDHRD NSPFDGPGGN LAHAFQPGPG IGGDAHFDED ERWTNNFREY NLHRVAAHEL GHSLGLSHST DIGALMYPSY TFSGDVQLAQ DDIDGIQAIY GRSQNPVQPI GPQTPKACDS KLTFDAITTI RGEVMFFKDR FYMRTNPFYP EVELNFISVF WPQLPNGLEA AYEFADRDEV RFFKGNKYWA VQGQNVLHGY PKDIYSSFGF PRTVKHIDAA LSEENTGKTY FFVANKYWRY DEYKRSMDPG YPKMIAHDFP GIGHKVDAVF MKDGFFYFFH GTRQYKFDPK TKRILTLQKA NSWFNCRKN. It is sometimes possible for the material contained within the vial of "MMP1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.