Lactadherin Isoform B (MFGE8) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Human Lactadherin (MFGE8)
Gene Names
MFGE8; BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lactadherin (MFGE8); N/A; Recombinant Human Lactadherin (MFGE8); Breast epithelial antigen BA46; HMFG; MFGM; Milk fat globule-EGF factor 8; MFG-E8; SED1; MFGE8 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-387aa; Full Length of Mature Protein
Sequence
LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for MFGE8 recombinant protein
Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization. Contributes to phagocytic roval of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction. Binds specifically to rotavirus and inhibits its replication. 1 Publication
Product Categories/Family for MFGE8 recombinant protein
References
Cloning and sequence analysis of human breast epithelial antigen BA46 reveals an RGD cell adhesion sequence presented on an epidermal growth factor-like domain.Couto J.R., Taylor M.R., Godwin S.G., Ceriani R.L., Peterson J.A.DNA Cell Biol. 15:281-286(1996)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56.8 kDa
NCBI Official Full Name
lactadherin isoform b
NCBI Official Synonym Full Names
milk fat globule-EGF factor 8 protein
NCBI Official Symbol
MFGE8
NCBI Official Synonym Symbols
BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
NCBI Protein Information
lactadherin
UniProt Protein Name
Lactadherin
UniProt Gene Name
MFGE8
UniProt Synonym Gene Names
MFG-E8
UniProt Entry Name
MFGM_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The MFGE8 mfge8 (Catalog #AAA15924) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-387aa; Full Length of Mature Protein. The amino acid sequence is listed below: LDICSKNPCH NGGLCEEISQ EVRGDVFPSY TCTCLKGYAG NHCETKCVEP LGMENGNIAN SQIAASSVRV TFLGLQHWVP ELARLNRAGM VNAWTPSSND DNPWIQVNLL RRMWVTGVVT QGASRLASHE YLKAFKVAYS LNGHEFDFIH DVNKKHKEFV GNWNKNAVHV NLFETPVEAQ YVRLYPTSCH TACTLRFELL GCELNGCANP LGLKNNSIPD KQITASSSYK TWGLHLFSWN PSYARLDKQG NFNAWVAGSY GNDQWLQVDL GSSKEVTGII TQGARNFGSV QFVASYKVAY SNDSANWTEY QDPRTGSSKI FPGNWDNHSH KKNLFETPIL ARYVRILPVA WHNRIALRLE LLGC . It is sometimes possible for the material contained within the vial of "Lactadherin (MFGE8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
