E3 ubiquitin-protein ligase ZNRF3 Active Protein | ZNRF3 active protein
Recombinant Human E3 ubiquitin-protein ligase ZNRF3
Gene Names
ZNRF3; RNF203; BK747E2.3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase ZNRF3 ; N/A; Recombinant Human E3 ubiquitin-protein ligase ZNRF3 ; RING finger protein 203; Zinc/RING finger protein 3; ZNRF3 active protein
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
56-219aa; Extracellular Domain
Sequence
KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for ZNRF3 active protein
E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone.
Product Categories/Family for ZNRF3 active protein
References
"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.
Nat. Genet. 36:40-45(2004)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34.2 kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase ZNRF3 isoform 1
NCBI Official Synonym Full Names
zinc and ring finger 3
NCBI Official Symbol
ZNRF3
NCBI Official Synonym Symbols
RNF203; BK747E2.3
NCBI Protein Information
E3 ubiquitin-protein ligase ZNRF3
UniProt Protein Name
E3 ubiquitin-protein ligase ZNRF3
UniProt Gene Name
ZNRF3
UniProt Synonym Gene Names
KIAA1133; RNF203
UniProt Entry Name
ZNRF3_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ZNRF3 znrf3 (Catalog #AAA18791) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 56-219aa; Extracellular Domain. The amino acid sequence is listed below: KETAFVEVVL FESSPSGDYT TYTTGLTGRF SRAGATLSAE GEIVQMHPLG LCNNNDEEDL YEYGWVGVVK LEQPELDPKP CLTVLGKAKR AVQRGATAVI FDVSENPEAI DQLNQGSEDP LKRPVVYVKG ADAIKLMNIV NKQKVARARI QHRPPRQPTE YFDM . It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase ZNRF3 , Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
