Left-Right Determination Factor 2 Preproprotein (Lefty2) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Mouse Left-right determination factor 2 (Lefty2)
Gene Names
Lefty2; Ebaf; Lefta; Leftb; lefty-2; lefty-B; 6030463A22Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Left-right determination factor 2 (Lefty2); N/A; Recombinant Mouse Left-right determination factor 2 (Lefty2); Lefty2 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
78-368. Full Length of Mature Protein
Sequence
FSQNFREVAGRFLMSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRFERLSPHSARARVTIEWLRVREDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSAHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEVPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTIGWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRGIDL
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Lefty2 recombinant protein
This gene encodes a member of the TGF-beta family of proteins. The encoded protein is secreted and plays a role in left-right asymmetry determination of organ systems during development. The protein may also play a role in endometrial bleeding. Mutations in this gene have been associated with left-right axis malformations, particularly in the heart and lungs. Some types of infertility have been associated with dysregulated expression of this gene in the endometrium. Alternative processing of this protein can yield three different products. This gene is closely linked to both a related family member and a related pseudogene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40.1 kDa
NCBI Official Full Name
left-right determination factor 2 preproprotein
NCBI Official Synonym Full Names
left-right determination factor 2
NCBI Official Symbol
Lefty2
NCBI Official Synonym Symbols
Ebaf; Lefta; Leftb; lefty-2; lefty-B; 6030463A22Rik
NCBI Protein Information
left-right determination factor 2
UniProt Protein Name
Left-right determination factor 2
UniProt Gene Name
Lefty2
UniProt Synonym Gene Names
Leftb
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The Lefty2 lefty2 (Catalog #AAA113886) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 78-368. Full Length of Mature Protein. The amino acid sequence is listed below: FSQNFREVAG RFLMSETSTH LLVFGMEQRL PPNSELVQAV LRLFQEPVPR TALRRFERLS PHSARARVTI EWLRVREDGS NRTALIDSRL VSIHESGWKA FDVTEAVNFW QQLSRPRQPL LLQVSVQREH LGPGTWSAHK LVRFAAQGTP DGKGQGEPQL ELHTLDLKDY GAQGNCDPEV PVTEGTRCCR QEMYLDLQGM KWAENWILEP PGFLTYECVG SCLQLPESLT IGWPFLGPRQ CVASEMTSLP MIVSVKEGGR TRPQVVSLPN MRVQTCSCAS DGALIPRGID L. It is sometimes possible for the material contained within the vial of "Left-right determination factor 2 (Lefty2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.