Cytosol Aminopeptidase (AMPL) E Coli Recombinant Protein
Recombinant Bos taurus (Bovine) Cytosol aminopeptidase
Gene Names
LAP3; PEPS; LAP-3
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Cytosol aminopeptidase; N/A; Recombinant Bos taurus (Bovine) Cytosol aminopeptidase; Leucine aminopeptidase 3; LAP-3Leucyl aminopeptidasePeptidase SProline aminopeptidase (EC:3.4.11.5)Prolyl aminopeptidase; AMPL recombinant protein
Product Overview
Host
E Coli
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer50% glycerol
Sequence Positions
Partial, 25-64aa
Sequence
VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
Immunogen Description
Expression Region:25-64aaSequence Info:Full Length
Calculated MW
20.5 kDa
Tag Info
N-terminal 6xHis-SUMO-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C.
The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for AMPL recombinant protein
Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the roval of unsubstituted N-terminal amino acids from various peptides.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
cytosol aminopeptidase
NCBI Official Symbol
LAP3
NCBI Official Synonym Symbols
PEPS; LAP-3
NCBI Protein Information
cytosol aminopeptidase
UniProt Protein Name
Cytosol aminopeptidase
UniProt Gene Name
LAP3
UniProt Synonym Gene Names
LAP-3
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The AMPL lap3 (Catalog #AAA309760) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Partial, 25-64aa. The amino acid sequence is listed below: VRNSQSCRRN KGICVPIRCP GSMRQIGTCL GAQVKCCRRK. It is sometimes possible for the material contained within the vial of "Cytosol aminopeptidase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.