Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell IL10 Recombinant Protein – Cat# AAA116637 – SDS-PAGE SDS-PAGE

Interleukin-10 (IL10) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Macaca mulatta Interleukin-10 (IL10)

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-10 (IL10); N/A; Recombinant Macaca mulatta Interleukin-10 (IL10); Cytokine synthesis inhibitory factor; CSIF; IL10 recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-178aa; Full Length of Mature Protein
Sequence
SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Production Note
Special Offer: The Baculovirus, E Coli, Mammalian-Cell host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirus, E Coli, Mammalian-Cellhost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus, E Coli, Mammalian-Cell host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus, E Coli, Mammalian-Cell host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell IL10 Recombinant Protein – Cat# AAA116637 – SDS-PAGE SDS-PAGE
Related Product Information for IL10 recombinant protein
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Product Categories/Family for IL10 recombinant protein
References
Comparative sequence analysis of cytokine genes from human and nonhuman primates.Villinger F.J., Brar S.S., Mayne A.E., Chikkala N., Ansari A.A.J. Immunol. 155:3946-3954(1995)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.7 kDa
NCBI Official Full Name
interleukin-10
NCBI Official Symbol
IL10
NCBI Protein Information
interleukin-10
UniProt Protein Name
Interleukin-10
UniProt Gene Name
IL10
UniProt Synonym Gene Names
IL-10; CSIF
UniProt Entry Name
IL10_MACMU

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The IL10 il10 (Catalog #AAA116637) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-178aa; Full Length of Mature Protein. The amino acid sequence is listed below: SPGQGTQSEN SCTRFPGNLP HMLRDLRDAF SRVKTFFQMK DQLDNILLKE SLLEDFKGYL GCQALSEMIQ FYLEEVMPQA ENHDPDIKEH VNSLGENLKT LRLRLRRCHR FLPCENKSKA VEQVKNAFSK LQEKGVYKAM SEFDIFINYI EAYMTMKIQN. It is sometimes possible for the material contained within the vial of "Interleukin-10 (IL10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.