Interferon Gamma (Ifng) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Guinea Pig Interferon gamma (Ifng), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon gamma (Ifng); N/A; Recombinant Guinea Pig Interferon gamma (Ifng), partial; /; Ifng recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-166aa, Partial
Sequence
QSRFTNEIRILKNYFNADNSDVGDNGTLFVGILKNCQEESERKIFQSQIVSFYFKLFEKHFTDNQTVQNSMNTIKEQIITKFFKDNSSNKVQAFKNLIQISVNDEHVQRQAIIELKKVIDDLSPNQRKRRRTQMLFQSRRASK
Species
Cavia porcellus (Guinea pig)
Relevance
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for Ifng recombinant protein
References
A high-resolution map of human evolutionary constraint using 29 mammals.Lindblad-Toh K., Garber M., Zuk O., Lin M.F., Parker B.J., Washietl S., Kheradpour P., Ernst J., Jordan G., Mauceli E., Ward L.D., Lowe C.B., Holloway A.K., Clamp M., Gnerre S., Alfoldi J., Beal K., Chang J., Clawson H., Cuff J., Di Palma F., Fitzgerald S., Flicek P., Guttman M., Hubisz M.J., Jaffe D.B., Jungreis I., Kent W.J., Kostka D., Lara M., Martins A.L., Massingham T., Moltke I., Raney B.J., Rasmussen M.D., Robinson J., Stark A., Vilella A.J., Wen J., Xie X., Zody M.C., Baldwin J., Bloom T., Chin C.W., Heiman D., Nicol R., Nusbaum C., Young S., Wilkinson J., Worley K.C., Kovar C.L., Muzny D.M., Gibbs R.A., Cree A., Dihn H.H., Fowler G., Jhangiani S., Joshi V., Lee S., Lewis L.R., Nazareth L.V., Okwuonu G., Santibanez J., Warren W.C., Mardis E.R., Weinstock G.M., Wilson R.K., Delehaunty K., Dooling D., Fronik C., Fulton L., Fulton B., Graves T., Minx P., Sodergren E., Birney E., Margulies E.H., Herrero J., Green E.D., Haussler D., Siepel A., Goldman N., Pollard K.S., Pedersen J.S., Lander E.S., Kellis M.Nature 478:476-482(2011)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,590 Da
NCBI Official Full Name
interferon gamma
NCBI Official Symbol
Ifng
NCBI Protein Information
interferon gamma
UniProt Protein Name
Interferon gamma
UniProt Gene Name
Ifng
UniProt Synonym Gene Names
IFN-gamma
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The Ifng ifng (Catalog #AAA116150) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-166aa, Partial. The amino acid sequence is listed below: QSRFTNEIRI LKNYFNADNS DVGDNGTLFV GILKNCQEES ERKIFQSQIV SFYFKLFEKH FTDNQTVQNS MNTIKEQIIT KFFKDNSSNK VQAFKNLIQI SVNDEHVQRQ AIIELKKVID DLSPNQRKRR RTQMLFQSRR ASK. It is sometimes possible for the material contained within the vial of "Interferon gamma (Ifng), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.