Hbsag, Partial (HBsAg) Escherichia Coli. Recombinant Protein
Recombinant Hepatitis B Surface Antigen preS1
Purity
Purity: Greater than 97.0% as determined by: a) Analysis by RP-HPLC.
b)Analysis by SDS-PAGE.
Purification Method: Purified by proprietary chromatography technique.
Synonyms
Hepatitis B Surface Antigen preS1; N/A; Recombinant Hepatitis B Surface Antigen preS1; HBsAg preS1; Hepatitis B Surface Antigen, preS1 Recombinant; HBsAg recombinant protein
Product Overview
Host
Escherichia Coli.
Purity/Purification
Purity: Greater than 97.0% as determined by:
a) Analysis by RP-HPLC.
b)Analysis by SDS-PAGE.
Purification Method: Purified by proprietary chromatography technique.
a) Analysis by RP-HPLC.
b)Analysis by SDS-PAGE.
Purification Method: Purified by proprietary chromatography technique.
Form/Format
Lyophilized from 0.2 um filtered solution in 20mM PB, pH 7.4, and 50mM NaCl.
Sequence
MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASTNRQSGRQPTPISPPLRDSHPQA
Sequence Length
57
Solubility
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <= -20°C. Further dilutions should be made in appropiate buffered solutions.
Preparation and Storage
This lyophilized HBsAg preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Related Product Information for HBsAg recombinant protein
The Recombinant Hepatitis B Surface Antigen preS1 is approximately 12.6 kDa, a single non-glycosylated polypeptide chain contaning 119 amino acids.
Product Categories/Family for HBsAg recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
HBsAg, partial
UniProt Protein Name
HBsAg
UniProt Gene Name
HBsAg
UniProt Entry Name
Q09LT5_HBV
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The HBsAg hbsag (Catalog #AAA38296) is a Recombinant Protein produced from Escherichia Coli. and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGGWSSKPRQ GMGTNLSVPN PLGFFPDHQL DPAFGANSNN PDWDFNPNKD HWPEAHQVGA GAFGPGFTPP HGGLLGWSPQ AQGILTTVPV APPPASTNRQ SGRQPTPISP PLRDSHPQA. It is sometimes possible for the material contained within the vial of "Hepatitis B Surface Antigen preS1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.