Glucagon-Like Peptide 1 Receptor (GLP1R) Yeast Recombinant Protein
Recombinant Human Glucagon-like peptide 1 receptor
Gene Names
GLP1R; GLP-1; GLP-1R; GLP-1-R
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Glucagon-like peptide 1 receptor; N/A; Recombinant Human Glucagon-like peptide 1 receptor; GLP1R recombinant protein
Product Overview
Host
Yeast
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
Extracellular Domain, 24-145aa
Sequence
RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Calculated MW
16.3kD
Target Species
Human
Tag Info
His-tag
Preparation and Storage
Store at -20°C, for extended storage, conserve at -20° C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for GLP1R recombinant protein
Recombinant protein
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
glucagon-like peptide 1 receptor
NCBI Official Synonym Full Names
glucagon like peptide 1 receptor
NCBI Official Symbol
GLP1R
NCBI Official Synonym Symbols
GLP-1; GLP-1R; GLP-1-R
NCBI Protein Information
glucagon-like peptide 1 receptor
UniProt Protein Name
Glucagon-like peptide 1 receptor
UniProt Gene Name
GLP1R
UniProt Synonym Gene Names
GLP-1 receptor; GLP-1-R; GLP-1R
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The GLP1R glp1r (Catalog #AAA309775) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Extracellular Domain, 24-145aa. The amino acid sequence is listed below: RPQGATVSLW ETVQKWREYR RQCQRSLTED PPPATDLFCN RTFDEYACWP DGEPGSFVNV SCPWYLPWAS SVPQGHVYRF CTAEGLWLQK DNSSLPWRDL SECEESKRGE RSSPEEQLLF LY. It is sometimes possible for the material contained within the vial of "Glucagon-like peptide 1 receptor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.