Growth Hormone Receptor (GHR) Cell Free Expression Recombinant Protein
Recombinant Rabbit Growth hormone receptor (GHR), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Growth hormone receptor (GHR); N/A; Recombinant Rabbit Growth hormone receptor (GHR), partial; GHR recombinant protein
Product Overview
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
19-256aa; Partial
Sequence
FSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSP
Species
Oryctolagus cuniculus (Rabbit)
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
growth hormone receptor
NCBI Official Symbol
GHR
NCBI Protein Information
growth hormone receptor; GH receptor; somatotropin receptor
UniProt Protein Name
Growth hormone receptor
UniProt Gene Name
GHR
UniProt Synonym Gene Names
GH receptor; GH-binding protein; GHBP
UniProt Entry Name
GHR_RABIT
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The GHR ghr (Catalog #AAA244046) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-256aa; Partial. The amino acid sequence is listed below: FSGSEATPAT LGRASESVQR VHPGLGTNSS GKPKFTKCRS PELETFSCHW TDGVHHGLKS PGSVQLFYIR RNTQEWTQEW KECPDYVSAG ENSCYFNSSY TSIWIPYCIK LTNNGGMVDQ KCFSVEEIVQ PDPPIGLNWT LLNVSLTGIH ADIQVRWEPP PNADVQKGWI VLEYELQYKE VNETQWKMMD PVLSTSVPVY SLRLDKEYEV RVRSRQRSSE KYGEFSEVLY VTLPQMSP. It is sometimes possible for the material contained within the vial of "Growth hormone receptor (GHR), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.