Polypeptide N-Acetylgalactosaminyltransferase 10 (Galnt10) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Mouse Polypeptide N-acetylgalactosaminyltransferase 10 (Galnt10), partial
Gene Names
Galnt10; Galnt9; AU018154; GalNAc-T9; ppGaNTase; GalNAc-T10; C330012K04Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Polypeptide N-acetylgalactosaminyltransferase 10 (Galnt10); N/A; Recombinant Mouse Polypeptide N-acetylgalactosaminyltransferase 10 (Galnt10), partial; Galnt10 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
455-603. Fragment at the C-terminal, including the Ricin B-type lectin Domain
Sequence
PPAAAWGEIRNVGTGLCTDTKLGTLGSPLRLETCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRVFMNTCNPSSLTQQWLFEHTNSTVLENFNKN
Sequence Length
603
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Galnt10 recombinant protein
This gene belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) gene family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates. Two transcript variants encoding distinct isoforms have been identified for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
69,116 Da
NCBI Official Full Name
polypeptide N-acetylgalactosaminyltransferase 10
NCBI Official Synonym Full Names
polypeptide N-acetylgalactosaminyltransferase 10
NCBI Official Symbol
Galnt10
NCBI Official Synonym Symbols
Galnt9; AU018154; GalNAc-T9; ppGaNTase; GalNAc-T10; C330012K04Rik
NCBI Protein Information
polypeptide N-acetylgalactosaminyltransferase 10
UniProt Protein Name
Polypeptide N-acetylgalactosaminyltransferase 10
UniProt Gene Name
Galnt10
UniProt Synonym Gene Names
GalNAc-T10; pp-GaNTase 10
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The Galnt10 galnt10 (Catalog #AAA233572) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 455-603. Fragment at the C-terminal, including the Ricin B-type lectin Domain. The amino acid sequence is listed below: PPAAAWGEIR NVGTGLCTDT KLGTLGSPLR LETCIRGRGE AAWNSMQVFT FTWREDIRPG DPQHTKKFCF DAVSHTSPVT LYDCHSMKGN QLWKYRKDKT LYHPVSGSCM DCSESDHRVF MNTCNPSSLT QQWLFEHTNS TVLENFNKN. It is sometimes possible for the material contained within the vial of "Polypeptide N-acetylgalactosaminyltransferase 10 (Galnt10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.